KEGG   Bacillus subtilis subsp. subtilis 168: BSU09560
Entry
BSU09560          CDS       T00010                                 

Gene name
cueR
Definition
(RefSeq) MerR family transcriptional regulator
  KO
K11923  MerR family transcriptional regulator, copper efflux regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU09560 (cueR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    BSU09560 (cueR)
SSDB
Motif
Pfam: MerR_1 MerR HTH_17 LacI
Other DBs
NCBI-GeneID: 939283
NCBI-ProteinID: NP_388837
Pasteur: BG13023
BSORF: BG13023
UniProt: O07586 A0A6M4JRD6
LinkDB
Position
complement(1033458..1033889)
AA seq 143 aa
MVGRDIDGAETYRISELAALAGVTKRTVDYYTNLGLLTPARSCSNYRYYDENALKRLIFI
VDCKKQRLALSDIKDRLENQFPSSAKLDDEIGNLALEIDHMNQNISGILHRFERLKPEDR
DKLKSKLPPEKLAVFQSFMLLLS
NT seq 432 nt   +upstreamnt  +downstreamnt
atggttgggagggatatagatggggctgagacttatcgcatcagtgaactagcggcactc
gccggagtaacgaaacggacagttgattattatacgaatctcggtctgcttacgccggcc
agatcctgttcaaattaccgttactacgacgaaaatgcactcaaacgacttatatttatt
gtagattgcaagaagcagcgattggccctgtccgatattaaagatcgactggagaaccag
tttccctcttcagctaaacttgatgatgaaattggaaatctggcattagaaattgatcat
atgaatcaaaacatctccggaatcttgcatcggtttgaacggctgaagcccgaggatcgt
gacaagctgaaaagcaaactcccgcctgaaaagctcgccgtgttccaatcatttatgctg
ctgttaagttaa

DBGET integrated database retrieval system