KEGG   Bacillus subtilis subsp. subtilis 168: BSU09620
Entry
BSU09620          CDS       T00010                                 

Gene name
yhdW
Definition
(RefSeq) glycerophosphoryl diester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU09620 (yhdW)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     BSU09620 (yhdW)
SSDB
Motif
Pfam: GDPD GDPD_2
Other DBs
NCBI-GeneID: 939751
NCBI-ProteinID: NP_388843
Pasteur: BG13029
BSORF: BG13029
UniProt: O07592 A0A6M4JGZ3
LinkDB
Position
complement(1037688..1038419)
AA seq 243 aa
MYIIAHRGASGYAPENTIAAFDLAVKMNADMIELDVQLTKDRQIVVIHDDRVDRTTNGSG
FVKDFTLEELQKLDAGSWYGPAFQGERIPTLEAVLKRYHKKIGLLIELKGHPSQVGIEEE
VGQLLGQFSFSINNIVQSFQFRSVQRFRELYPSIPTAVITRPNFGMLSRNQMKAFRSFAN
YVNIKHTRLNRLMIGSINKNGLNIFAWTVNNQKTAAKLQAMGVDGIVTDYPDFIIKDGKH
ENI
NT seq 732 nt   +upstreamnt  +downstreamnt
ttgtacatcattgcccatcgcggagcatccggctacgctccggaaaatacgattgccgca
tttgaccttgcggtgaaaatgaatgcagatatgatcgaactggatgtccagcttacaaaa
gacaggcagattgttgtgatacacgatgacagggttgaccgaacaacaaacggatcgggc
tttgttaaggattttaccttggaggaattgcaaaaactcgatgcaggaagctggtacggt
cccgcttttcaaggagagcgtattccaaccctggaagcggtgctcaagcgctaccacaaa
aaaatcggccttttaattgaactaaaaggccatccgtctcaagtcggaattgaagaagag
gtgggacagctattagggcaattttctttttctatcaataatattgttcaatcctttcag
ttccgctccgtccaaaggttccgcgagctttatccttcgattccgacagcggtcattaca
aggcccaactttggcatgctgtccagaaatcagatgaaggccttccgctcttttgcaaac
tatgtcaatataaaacacacacggcttaaccgtctgatgatcggctccatcaataaaaat
ggcttaaacatatttgcatggactgtcaacaatcaaaagacagcggcaaaattacaagcc
atgggcgtggacggcatcgttacagattacccggatttcatcataaaggatggcaaacat
gaaaatatatag

DBGET integrated database retrieval system