KEGG   Bacillus subtilis subsp. subtilis 168: BSU09680
Entry
BSU09680          CDS       T00010                                 

Symbol
nhaC
Name
(RefSeq) Na(+)/H(+) antiporter NhaC
  KO
K03315  Na+:H+ antiporter, NhaC family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09680 (nhaC)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU09680 (nhaC)
SSDB
Motif
Pfam: Na_H_antiporter
Other DBs
NCBI-GeneID: 936274
NCBI-ProteinID: NP_388849
Pasteur: BG13044
BSORF: BG13044
UniProt: O07553 A0A6M3Z8Y5
LinkDB
Position
complement(1042885..1044246)
AA seq 453 aa
MDSQKKLTFPLAVGLFIFMLCIIISCLFLLHVEPHIPLFLSVVMLSAAALWFGFPWKSIE
KGIVDGIKNGVQPIIVLALIGILIGAWMYSGAIPTMTVYALSFIEPSHLLLTALFSCMII
STLVGSSLTTVSTIGVALIGVASAAGVPLEWTAGAVICGACFGDKMSPMSDTTNFAAGIG
EIPIFEHIRHMMGTTIPALLITVVLFYFLGSSVSADAASTDNIQQVITGIKDAANVTPWA
LLSPLLVVLLAMKRVSVIPVLTAGIISSGILTAIFVPYSSLQAFMTALQNGTTFETDNEA
AAKIINRGGLQSMMGSVSLIMIAFALGGLMEKIGLISALLEGVMKGIRSKGRLVAATVCS
SIGVNLATGEQYLSILIPGQSFKSLYDKRNIQRKFLTRSLEDGGTLINPLIPWGVSGAFM
ASALGVPVIDYIPFTFFLYISPMISILIGFVKK
NT seq 1362 nt   +upstreamnt  +downstreamnt
ttggattctcaaaaaaagctgacgtttccgttagccgtcggtttatttatattcatgttg
tgcattattatttcttgcttattcttgcttcatgtagaacctcatatcccgctgttttta
agtgttgtcatgctttcagcagcagctttatggtttggatttccctggaagagcattgaa
aaagggattgtagacgggatcaaaaacggcgtacagccgattattgttctagcgctgatc
ggcatcttaatcggcgcctggatgtacagcggcgcaataccgactatgacagtttatgcc
ctatcctttattgaaccaagccaccttctgttgactgctttgttttcatgtatgatcatc
agcacacttgttggctcaagtctgacaactgtaagcacaatcggagtagcgctgatcggc
gtggcgagcgcggctggcgttccgcttgaatggacagcaggcgcagtcatatgcggcgct
tgttttggggataaaatgtcgccgatgtcggacacaaccaactttgcagccggaataggc
gaaataccaatctttgaacacattcgccatatgatgggcacaaccattccagctttgctc
atcactgtcgttctgttttactttctcggttcatcagtgtcagcggacgctgcttcaacc
gataatattcagcaggtcataaccggaataaaagatgctgcaaacgtgacaccgtgggcc
cttctttctccgctcttagtcgttttgctggcaatgaaacgggtatcagtaatccccgtt
ctgactgccggaattatttcctcgggaattttgactgctatttttgtaccctacagcagc
ctgcaggcgtttatgacagctttacaaaatggcacaactttcgaaactgacaatgaggca
gccgctaaaattattaacagaggcggactgcaatccatgatgggctctgtctctctcatt
atgattgcttttgcactcggcggattgatggagaaaatcggattgatttctgcactattg
gaaggcgtcatgaaaggcatccgctcaaaaggccgtcttgttgcagcaactgtctgctca
agcatcggcgtcaacttggcaacgggcgaacagtatttatcgatattaataccgggacaa
tcatttaaatctttatatgacaaacgaaacatccagcgaaaatttctgacaagatcatta
gaggacggcggaacattaattaacccattgattccttggggcgtcagcggcgcatttatg
gcgagcgcacttggtgttccagtcatagactacatcccatttacgttcttcctctatata
tcgccaatgatctccattttgattggatttgttaaaaaataa

DBGET integrated database retrieval system