KEGG   Bacillus subtilis subsp. subtilis 168: BSU09710
Entry
BSU09710          CDS       T00010                                 
Symbol
yheI
Name
(RefSeq) multidrug resistance ABC transporter ATP-binding/permease protein YheI
  KO
K18889  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU09710 (yheI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09710 (yheI)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU09710 (yheI)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N ATP-synt_ab NB-ARC RsgA_GTPase AAA_16 AAA_7 AAA_18 AAA_23 TsaE MobB AAA_22 TrwB_AAD_bind MMR_HSR1 cobW Zeta_toxin DUF87 Viral_helicase1 AAA_29
Other DBs
NCBI-GeneID: 936278
NCBI-ProteinID: NP_388852
Pasteur: BG13041
BSORF: BG13041
UniProt: O07550 A0A6M3Z8Z2
LinkDB
Position
1045318..1047075
AA seq 585 aa
MFSVLKKLGWFFKAYWLRYTIAIVLLLAVNVIEMFPPKLLGNAIDDMKAGAFTAEGLLFY
IGIFFVLTAAVYIMSYFWMHQLFGGANLMEKILRTKLMGHLLTMSPPFYEKNRTGDLMAR
GTNDLQAVSLTTGFGILTLVDSTMFMMTIFLTMGFLISWKLTFAAIIPLPVMAIAISLYG
SKIHERFTEAQNAFGALNDRVLESVSGVRVIRAYVQETNDVRRFNEMTADVYQKNMKVAF
IDSLFEPTVKLLVGASYLIGLGYGAFLVFRNELTLGELVSFNVYLGMMIWPMFAIGELIN
VMQRGNASLDRVNETLSYETDVTDPKQPADLKEPGDIVFSHVSFTYPSSTSDNLQDISFT
VRKGQTVGIAGKTGSGKTTIIKQLLRQYPPGEGSITFSGVPIQQIPLDRLRGWIGYVPQD
HLLFSRTVKENILYGKQDATDKEVQQAIAEAHFEKDLHMLPSGLETMVGEKGVALSGGQK
QRISIARALMANPEILILDDSLSAVDAKTEAAIIKNIRENRKGKTTFILTHRLSAVEHAD
LILVMDGGVIAERGTHQELLANNGWYREQYERQQLFTAEEGGAGA
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgttttcagttttgaaaaagcttggctggttttttaaggcgtactggctgcgctatacg
attgcgattgtccttttattagcagtcaatgtcattgaaatgtttccgcctaagctcttg
gggaacgccatagatgatatgaaagcaggggcatttactgcggaagggctgctgttttat
atcggtatcttttttgtgctgacggcggccgtgtatatcatgtcttatttttggatgcat
cagctgtttggcggagcgaatctgatggagaaaattcttcgtacgaagctgatggggcat
ttgctgactatgtcgccgccgttttatgaaaaaaaccgaacaggcgatttaatggcacga
gggacaaatgatcttcaggccgtcagtttaaccacagggtttggcatcttgacgttagtt
gattctacgatgtttatgatgacgatctttttgacaatggggtttttgatcagctggaag
ctgacctttgccgccattatcccgcttccagtcatggcgattgcaatcagtctatatgga
agtaaaattcatgagcggtttactgaggcccaaaacgcgttcggggcgctgaatgacaga
gtgctggaatctgtttcaggcgtgcgggtgattcgcgcgtatgttcaggaaacaaacgat
gttcgccggtttaatgaaatgaccgctgatgtttatcagaaaaatatgaaagtggctttt
attgattcactgtttgagccgacggtaaaactgcttgtcggcgcaagctatctgattggg
ctcggctacggagcgtttcttgtattccggaacgagctgacgcttggagagttagtgtcc
tttaacgtttatctcggcatgatgatttggccgatgtttgcaatcggtgaactcattaat
gtgatgcagcgcggcaatgcgtcattagatcgggtaaatgaaactctttcttatgaaacg
gatgtgacagatccaaaacagcccgctgatcttaaagagcctggagatatcgttttcagt
catgtcagctttacatatccaagctcaacaagtgacaatcttcaggatatttcatttacg
gtgcgaaaagggcagactgtcgggattgcaggtaaaaccgggagcggaaaaacgacaatt
attaagcagcttttgcgccagtatcctccaggtgaagggagcattacattttcaggtgta
ccgattcagcaaatccctcttgaccgtctccgcggatggatcggatatgtgcctcaggat
catttactgttttcacggactgtaaaagaaaatattttatacggaaaacaggatgcaact
gataaagaggttcagcaagccattgccgaagcacattttgaaaaagatttgcacatgctt
ccgtccggtctggagacaatggtcggtgaaaaaggcgtggcactgtcaggcgggcagaaa
caaagaatttcgatcgcgagagcactcatggcgaatccggaaatcttgattctggatgat
tcactttccgctgtagatgccaaaacagaggctgcaattatcaagaacatcagagaaaac
cgcaaaggaaaaacgacatttattttgacacaccgattatccgcggtagagcacgctgac
ctgatccttgtgatggacggcggcgtcattgctgagagaggcacgcatcaagaactgctg
gccaataatgggtggtaccgggaacaatatgaaagacagcagctgttcactgcggaagaa
gggggagcaggggcatga

DBGET integrated database retrieval system