KEGG   Bacillus subtilis subsp. subtilis 168: BSU09720
Entry
BSU09720          CDS       T00010                                 
Symbol
yheH
Name
(RefSeq) multidrug resistance ABC transporter ATP-binding/permease protein YheH
  KO
K18890  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU09720 (yheH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09720 (yheH)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU09720 (yheH)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 RsgA_GTPase AAA_22 MMR_HSR1 AAA_21 AAA_29 DUF2207 AAA_23 AAA_30 AAA_10 AAA_15 Dynamin_N
Other DBs
NCBI-GeneID: 939287
NCBI-ProteinID: NP_388853
Pasteur: BG13040
BSORF: BG13040
UniProt: O07549 A0A6M4JGJ5
LinkDB
Position
1047072..1049093
AA seq 673 aa
MKIGKTLWRYALLYRKLLITAVLLLTVAVGAELTGPFIGKKMIDDHILGIEKTWYEAAEK
DKNAVQFHGVSYVREDRLQEPVSKAKEAHIYQVGMAFYFVDQAVSFDGNRTVSDGKLTIT
NGDKSRAYAAEKLTKQELFQFYQPEIKGMVLLICLYGGLLVFSVFFQYGQHYLLQMSANR
IIQKMRQDVFSHIQKMPIRYFDNLPAGKVVARITNDTEAIRDLYVTVLSTFVTSGIYMFG
IFTALFLLDVKLAFVCLAIVPIIWLWSVIYRRYASYYNQKIRSINSDINAKMNESIQGMT
IIQAFRHQKETMREFEELNESHFYFQNRMLNLNSLMSHNLVNVIRNLAFVCLIWHFGGAS
LNAAGIVSIGVLYAFVDYLNRLFQPITGIVNQFSKLELARVSAGRVFELLEEKNTEEAGE
PAKERALGRVEFRDVSFAYQEGEEVLKHISFTAQKGETVALVGHTGSGKSSILNLLFRFY
DAQKGDVLIDGKSIYNMSRQELRSHMGIVLQDPYLFSGTIGSNVSLDDERMTEEEIKNAL
RQVGAEPLLKKLPKGINEPVIEKGSTLSSGERQLISFARALAFDPAILILDEATAHIDTE
TEAVIQKALDVVKQGRTTFVIAHRLSTIRNADQILVLDKGEIVERGNHEELMALEGQYYQ
MYELQKGQKHSIA
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgaaaataggaaaaacgttatggagatacgcacttctttatcgaaaattgctgatcaca
gccgtccttttgctaactgttgccgtcggtgcagaactgactgggccctttattggcaaa
aaaatgatagacgaccatatcctcggcattgagaaaacatggtatgaagctgcggaaaaa
gataaaaatgccgttcagtttcacggcgtctcatatgtcagagaggaccgattgcaggag
cctgtttcaaaagcaaaagaagcgcatatttatcaagtgggaatggcgttctattttgtt
gatcaggctgtcagcttcgacgggaatagaacggtttctgacgggaagctgacgatcaca
aacggagacaagagccgggcatatgctgccgaaaagctgactaagcaggaacttttccag
ttctatcagccggaaataaagggaatggtgttactgatctgcctgtatgggggcttgctt
gtgttttcggtattctttcaatacggacagcattatctgctgcagatgagcgccaatcgg
attattcaaaagatgaggcaggacgtgttttcgcacatacagaaaatgccgattcgctat
tttgacaaccttccggccggaaaagtcgttgcgcggattaccaatgatacggaggctatt
agggatttatatgtcacagtgctttcaacatttgtgacaagcggaatctatatgttcggg
atattcacggctttgtttctgcttgatgtgaagcttgcgtttgtatgtctggcaattgtg
ccgattatctggctgtggtcggtcatataccggagatatgcgtcatattacaaccaaaaa
atccgctcgatcaacagtgacattaacgcaaaaatgaatgagtcaattcaaggcatgacc
attattcaggctttccgccatcaaaaggaaacaatgagagaatttgaggaattaaatgaa
tcacatttttatttccaaaacaggatgctgaatttaaactccttaatgtcccataatctg
gtcaatgtcatccgcaatcttgcgttcgtctgtctgatctggcattttggcggtgcgagc
ctgaatgcggcggggattgtttctatcggtgtgctgtacgcgtttgtcgattatttgaac
cggttatttcagccgatcacaggcatcgtcaatcagttttcaaagctggagcttgcaagg
gtctccgccgggcgtgtttttgaactgcttgaagaaaagaatacggaagaagcgggtgaa
ccggcgaaggagcgcgcgctggggcgggttgaatttcgtgatgtgtcatttgcgtatcaa
gaaggtgaagaggtattaaagcatatttcctttactgcgcaaaaaggcgaaaccgtagcg
ctcgtcggccataccggatcaggaaaaagctcgattttgaatcttctgtttcgtttttat
gatgcgcaaaaaggtgatgtcttaattgatggaaaaagcatttacaacatgtcaagacag
gaactcagatcccatatgggtattgtgcttcaggacccgtacttattctcgggcacaatc
ggatctaacgtaagtctggatgacgaaagaatgactgaagaagaaataaaaaatgcactg
cggcaagtcggtgctgagcctcttcttaagaagcttccgaagggcattaatgagcccgtg
attgaaaaaggcagcacgctatcctctggagagcggcagttaatttctttcgctagagct
ttggcgtttgatcccgcgatcttgattttagatgaggcaacggcgcatattgatacagag
acagaggccgtgatccagaaggcgcttgatgtcgtcaaacaaggacgcaccaccttcgtc
atcgctcaccggctttcaacaatcagaaatgctgatcagattttggttcttgataaagga
gaaattgttgagagagggaaccacgaggaactgatggcattagaaggccaatattatcaa
atgtatgaactgcaaaagggacagaaacattccattgcataa

DBGET integrated database retrieval system