KEGG   Bacillus subtilis subsp. subtilis 168: BSU09880
Entry
BSU09880          CDS       T00010                                 

Symbol
yhaR
Name
(RefSeq) enoyl-CoA hydratase/isomerase YhaR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 939767
NCBI-ProteinID: NP_388869
Pasteur: BG12994
BSORF: BG12994
UniProt: O07533 A0A6M3Z9J1
LinkDB
Position
1061491..1062258
AA seq 255 aa
MEFVQYACNGAVAEIILNRPDAHHALNEQMLSELKEAVEMAAASEALIVLLRGSGKGFSA
GGDIRMMTSEHDPDQFKRLMDTIEAVTLNLYQMKKVTIAAIHGAAAGLGLSLALCADIVL
AEKNAVLAMNFIGIGLVPDGGGHYLLKKRIGEAKAKKLIWSGKKLSASEAADMGLLDGTF
AGDPAEGARPIIETLLASPLLAMIETKGIFQSLQIEELKKVLSLERSAQERMRRTKDHQE
GIRAFLEKREPKFQA
NT seq 768 nt   +upstreamnt  +downstreamnt
atggagtttgttcaatatgcatgtaatggggccgttgcagagattatcctgaatcggcct
gatgcccatcacgccctgaatgaacagatgctgtctgaattgaaggaggcagtcgaaatg
gcggctgcaagcgaggcgctcatcgttctcctgagaggaagcgggaaaggcttttcggcc
ggcggtgatatcaggatgatgacgtcagagcatgaccctgaccaatttaaacggctgatg
gatacgattgaggctgtcaccctgaatttatatcagatgaagaaagtgacaattgcagcc
attcatggtgctgctgcgggactgggcctgagtttggcgctttgtgcggacattgtgctc
gctgaaaaaaacgccgttctcgcgatgaattttatcggcattgggcttgttccggacggc
ggaggacattatttgctgaagaaaagaatcggtgaagcaaaagcgaaaaaactgatttgg
agcggaaaaaaactatctgcctcggaagctgccgatatggggcttcttgatgggacattt
gccggagaccctgccgaaggcgcaagacccattatcgaaaccctgttggcctcccctctt
ttggcgatgatcgaaacgaaaggtatttttcaaagcctccaaattgaagaactgaaaaaa
gtgctatcccttgagcgcagcgcccaagagagaatgagaaggaccaaggatcaccaagaa
ggaatccgtgcctttttagaaaaacgggagccgaagtttcaagcgtaa

DBGET integrated database retrieval system