KEGG   Bacillus subtilis subsp. subtilis 168: BSU09890
Entry
BSU09890          CDS       T00010                                 
Symbol
natA
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09890 (natA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU09890 (natA)
SSDB
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 AAA_27 SbcC_Walker_B
Other DBs
NCBI-GeneID: 936283
NCBI-ProteinID: NP_388870
Pasteur: BG12993
BSORF: BG12993
UniProt: C0SPB4 A0A6M3Z951
LinkDB
Position
1062591..1063487
AA seq 298 aa
MLTIDHVTKTFGDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISW
KGRPVNYHISNKIGYLPEERGLYPKMKVRDQLVYLARLKGMEKREAVKELGTWLERFNIT
DYENKKVEELSKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNSGV
SILFSSHRMEHVEELCENLCILQKGKPVVQGKLKEIKRSFGKKNVTIHSDDDLRFLQSHE
GILQWKETADGVKLQIANEDISQEIFAMLQGKGFIRKFELEEPSLHDIFIEKVGAVYE
NT seq 897 nt   +upstreamnt  +downstreamnt
gtgcttacaattgatcacgtaacgaagacatttggagattataaagccgttgacggattg
gacttagatattccggaacagcaaatgttcggtctattaggcgcaaacggagcgggaaaa
acaacaacgtttcgcatgatcctaggattattaagcattacggagggctcaatcagctgg
aagggccgtcctgtgaattatcatatcagcaacaaaatcggttatttgccggaagagcgg
ggcctttatccgaaaatgaaggtaagggatcagctcgtctatcttgccagattaaaaggg
atggagaagcgagaggctgtaaaagagctcgggacatggcttgaacgcttcaatattaca
gattacgagaataagaaggtggaagagctttcgaaggggaatcagcagaaaatccaattc
atttcggcagttttgcataagccggagctcctgattcttgatgaaccattcagcggcttg
gaccctgtcaatgttgagctgctaaaagaggccgtgatctcgctgaaaaacagcggtgtt
tctattttattttcaagccatcggatggaacatgtggaggagctttgtgagaacctttgc
atattgcagaaaggaaaaccggttgtacaaggcaagctgaaggagatcaagcgttctttc
ggtaaaaagaatgttaccattcactccgatgacgatctgcgctttttgcagtcccatgaa
ggcattcttcaatggaaggaaacggcagacggcgtcaagctgcagattgccaatgaagac
atttctcaagagatttttgcgatgctccaaggaaaagggtttatcagaaagtttgagctt
gaagagccgtcactgcatgatatttttatagaaaaggtgggggccgtctatgaataa

DBGET integrated database retrieval system