KEGG   Bacillus subtilis subsp. subtilis 168: BSU10380Help
Entry
BSU10380          CDS       T00010                                 

Gene name
hemAT
Definition
(RefSeq) heme-based aerotactic transducer HemAT
  KO
K06595  heam-based aerotactic trancducer
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU10380 (hemAT)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU10380 (hemAT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Protoglobin MCPsignal HisK_N CK2S DUF948 DUF2258
Motif
Other DBs
NCBI-GeneID: 936320
NCBI-ProteinID: NP_388919
Pasteur: BG13066
BSORF: BG13066
UniProt: O07621
LinkDB All DBs
Structure
PDB: 

Position
complement(1112620..1113918)
Genome map
AA seq 432 aa AA seqDB search
MLFKKDRKQETAYFSDSNGQQKNRIQLTNKHADVKKQLKMVRLGDAELYVLEQLQPLIQE
NIVNIVDAFYKNLDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIA
SIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLVLEAF
QSEYNQTRDEQEEKKNLLHQKIQETSGSIANLFSETSRSVQELVDKSEGISQASKAGTVT
SSTVEEKSIGGKKELEVQQKQMNKIDTSLVQIEKEMVKLDEIAQQIEKIFGIVTGIAEQT
NLLSLNASIESARAGEHGKGFAVVANEVRKLSEDTKKTVSTVSELVNNTNTQINIVSKHI
KDVNELVSESKEKMTQINRLFDEIVHSMKISKEQSGKIDVDLQAFLGGLQEVSRAVSHVA
ASVDSLVILTEE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgttatttaaaaaagacagaaaacaagaaacagcttacttttcagattcaaacggacaa
caaaaaaaccgcattcagctcacaaacaaacatgcagatgtcaaaaaacagctcaaaatg
gtcaggttgggagatgctgagctttatgtgttagagcagcttcagccactcattcaagaa
aatatcgtaaatatcgtcgatgcgttttataaaaaccttgaccatgaaagctcattgatg
gatatcattaatgatcacagctcagttgaccgcttaaaacaaacgttaaaacggcatatt
caggaaatgtttgcaggcgttatcgatgatgaatttattgaaaagcgtaaccgaatcgcc
tccatccatttaagaatcggccttttgccaaaatggtatatgggtgcgtttcaagagctc
cttttgtcaatgattgacatttatgaagcgtccattacaaatcagcaagaactgctaaaa
gccattaaagcaacaacaaaaatcttgaacttagaacagcagcttgtccttgaagcgttt
caaagcgagtacaaccagacccgtgatgaacaagaagaaaagaaaaaccttcttcatcag
aaaattcaagaaacctctggatcgattgccaatctgttttcagaaacaagcagatcagtt
caagagcttgtggacaaatctgaaggcatttctcaagcatccaaagccggcactgtaaca
tccagcactgttgaagaaaagtcgatcggcggaaaaaaagagctagaagtccagcaaaaa
cagatgaacaaaattgacacaagccttgtccaaatcgaaaaagaaatggtcaagctggat
gaaatcgcgcagcaaattgaaaaaatcttcggcatcgtcacaggcatagctgaacaaaca
aaccttctctcgctcaatgcatctattgaatccgcccgcgccggagaacacggcaaaggc
tttgctgtcgtggcaaatgaagtgcggaagctttctgaggatacgaaaaaaaccgtctct
actgtttctgagcttgtgaacaatacgaatacacaaatcaacattgtatccaagcatatc
aaagacgtgaatgagctagtcagcgaaagtaaagaaaaaatgacgcaaattaaccgctta
ttcgatgaaatcgtccacagcatgaaaatcagcaaagagcaatcaggcaaaatcgacgtc
gatctgcaagcctttcttggagggcttcaggaagtcagccgcgccgtttcccatgtggcc
gcttccgttgattcgcttgtcatcctgacagaagaataa

DBGET integrated database retrieval system