KEGG   Bacillus subtilis subsp. subtilis 168: BSU10460
Entry
BSU10460          CDS       T00010                                 
Symbol
yhjC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3311
Other DBs
NCBI-GeneID: 939777
NCBI-ProteinID: NP_388927
Pasteur: BG13070
BSORF: BG13070
UniProt: O07557 A0A6M3Z963
LinkDB
Position
complement(1120628..1120828)
AA seq 66 aa
MKLIHVLAALPFIGILLGIPFANKVTPYVFGMPFILAYIVMWALLTSALMAIVYVLDKEN
KKEEAE
NT seq 201 nt   +upstreamnt  +downstreamnt
atgaaactgattcacgttcttgccgctttaccctttatcggaatcttactcggcatccct
tttgcaaataaggtgaccccctatgtgttcggcatgccgtttattcttgcctatattgtg
atgtgggctcttttgacctctgcgctgatggcgattgtgtatgtcctcgacaaggaaaat
aaaaaggaggaagcagaatga

DBGET integrated database retrieval system