KEGG   Bacillus subtilis subsp. subtilis 168: BSU10550
Entry
BSU10550          CDS       T00010                                 

Gene name
ntdA
Definition
(RefSeq) 3-oxo-glucose-6-phosphate--glutamate aminotransferase
  KO
K18653  3-dehydro-glucose-6-phosphate---glutamate transaminase [EC:2.6.1.104]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00998  Biosynthesis of various secondary metabolites - part 2
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00877  Kanosamine biosynthesis, glucose 6-phosphate => kanosamine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    BSU10550 (ntdA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.104  3-dehydro-glucose-6-phosphate---glutamate transaminase
     BSU10550 (ntdA)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase OKR_DC_1
Other DBs
NCBI-GeneID: 939788
NCBI-ProteinID: NP_388936
Pasteur: BG13078
BSORF: BG13078
UniProt: O07566 A0A6M3Z955
LinkDB
Structure
PDB: 
4K2M 4K2I 4K2B

Position
complement(1128286..1129611)
AA seq 441 aa
MQKQVKISGKSKENMSLLKHLKGDVQGKELVIEDSIVNERWKQVLKEKIDIEHDLFNYQK
NREISKVPFLPVDRLITNDEVEDILNTLTEVLPTGKFTSGPYLEQFEKVLSTYLHKRYVI
ATSSGTDAIMIGLLALGLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPD
KIEEAITPYTKFILPVHLYGKHSDMQHIRQIANRYKLKVIEDACQGIGLTDLGKYADITT
LSFNPYKNFGVCGKAGAIATDNEELAKKCIQFSYHGFEVNVKNKKVINFGFNSKMDNLQA
AIGLERMKYLSLNNFKRLFLADRYITQLAELQNKGYIELPELSEDHVWHLFPIKVRTEDR
ADIMTKLNEDFGVQTDVYYPILSHMQKTPLVQDKYAGLQLVHTEKAHSQVLHLPLYPSFT
LEEQDRVMEGLFHVIKQEIGV
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgcaaaaacaggttaagatttcaggtaaaagcaaagaaaacatgtcactattaaaacac
ttaaaaggtgacgtacaaggaaaagaacttgttattgaagacagtattgtaaacgagcgg
tggaaacaagtattaaaagaaaagatagatattgaacatgaccttttcaactatcaaaaa
aatcgtgaaatcagtaaagtcccttttttgcctgtagacagattaataaccaatgatgaa
gtggaagatatcttaaatacattaactgaagttttgccaactggaaaatttacgagtggt
ccctatttagagcaattcgaaaaagttttatctacatatttacataaaaggtatgtaatt
gcaaccagcagtggaaccgatgctattatgataggtttattggctttagggttaaaccca
ggggatgaagttatcatgccggctaatagcttttcagctactgaaaatgctgtgttagct
tcgggaggcgttcctatctatgtagatattaacccacaaacattctgcatcgatcctgac
aaaattgaagaagcaataactccttatacaaagtttattctacctgtgcatttatacgga
aaacattcagacatgcagcatatccgtcaaatcgcaaatcgttataaattaaaagtaatt
gaagatgcctgccaaggaattggactgacagacttaggaaagtatgcagacatcactaca
ttaagttttaatccctataagaattttggtgtatgtggcaaggctggggcaatagcaact
gataatgaagaactcgctaaaaaatgcattcaatttagttatcacggttttgaagtaaat
gtaaaaaataagaaagtcatcaattttggatttaattcaaaaatggacaatttacaggca
gcaattggtttagagagaatgaagtacctttcattaaacaacttcaaaagattgttcttg
gcggatagatacattacccaattagcagagttgcagaataaaggctatattgaattacca
gaattaagtgaagatcatgtatggcatctgtttcctattaaggtaagaacagaagatagg
gcagatatcatgactaaattaaatgaagattttggtgttcaaacagatgtatattatcca
atactttctcatatgcaaaaaactcctttagtacaggacaagtatgcaggactccaattg
gttcatacggaaaaggctcatagtcaggtactgcatttgcctttatatccgtcatttact
ttagaagaacaagacagagtaatggagggactgtttcatgttattaagcaagaaatcgga
gtataa

DBGET integrated database retrieval system