KEGG   Bacillus subtilis subsp. subtilis 168: BSU10770
Entry
BSU10770          CDS       T00010                                 

Symbol
wprA
Name
(RefSeq) cell wall-associated protease
  KO
K13274  cell wall-associated protease [EC:3.4.21.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU10770 (wprA)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU10770 (wprA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BSU10770 (wprA)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S8: subtilisin family
   BSU10770 (wprA)
Chaperones and folding catalysts [BR:bsu03110]
 Intramolecular chaperones
  Subtilisin family
   BSU10770 (wprA)
SSDB
Motif
Pfam: Peptidase_S8 Big_6 bMG3
Other DBs
NCBI-GeneID: 936350
NCBI-ProteinID: NP_388958
Pasteur: BG11846
BSORF: BG11846
UniProt: P54423 A0A6M3Z993
LinkDB
Position
1153789..1156473
AA seq 894 aa
MKRRKFSSVVAAVLIFALIFSLFSPGTKAAAAGAIDQAAALENGKEQTGAMKEPEQVKWY
KVTPGATDIQKNSHMALTVKSDSVLNVSVYPSKEKALKDETFEMYRSFTAEDGKSEVIFP
YAWSGPYYVKVEYLGEEEPEDGGTAEAAAEAKYTIGYKGTKKQPSDLEEEEACPVEMSVD
QKKSGKGILDKLRSIRDEQLSQTAEGKELTSLYYKAAPFIVAKLALNKTARNEIYQDLVT
LKPLFDDVSENGASSSYKVTEKDQKAINRLYDKALQSVPSFLKEEIKKQADRLNMKQLQG
KTAGAILTENNIAAKSEVQTTKVIFKVKDNKSLSSVHNEMKGFSASAQSKKDISNVKKAK
KLFDNLYSFELPKDEKQNGAYTASAKRVKSAAATLSKMSNVEFAEPVQEYKSLANDIQYP
YQWPLKNNGENGGVKNADVKYEPANTLLSKRKLNDTLIAVVDTGVDSTLADLKGKVRTDL
GHNFVGRNNNAMDDQGHGTHVAGIIAAQSDNGYSMTGLNAKAKIIPVKVLDSAGSGDTEQ
IALGIKYAADKGAKVINLSLGGGYSRVLEFALKYAADKNVLIAAASGNDGENALSYPASS
KYVMSVGATNRMDMTADFSNYGKGLDISAPGSDIPSLVPNGNVTYMSGTSMATPYAAAAA
GLLFAQNPKLKRTEVEDMLKKTADDISFESVDGGEEELYDDYGDPIEIPKTPGVDWHSGY
GRLNVMKAVSAADLQLKVNKLESTQTAVRGSAKEGTLIEVMNGKKKLGSAKAGKDNAFKV
NIATQKQDQVLYLKATKGDAKTSYKVVVVKGKPSGTPKVNAVKTKDTAVKGKANSKAMIR
VKNKSKKVIASAKADAKGTFSVKIKKQKAGTVLYVTAVDTDKKESKEAKVVVEK
NT seq 2685 nt   +upstreamnt  +downstreamnt
atgaaacgcagaaaattcagctcggttgtggcggcagtgcttatttttgcactgattttc
agccttttttctccgggaaccaaagctgcagcggccggcgcgatcgatcaggcggctgct
ctggaaaacggcaaagagcagacaggcgccatgaaggagccggaacaggtgaaatggtac
aaagtgaccccgggagcaacggatattcagaaaaactcacatatggcactgaccgtaaag
agtgattcagtactgaatgtatctgtatatccaagtaaggaaaaagcgcttaaagatgag
acgtttgagatgtaccgttctttcacagcggaggatggaaaaagcgaagtcatttttcca
tacgcgtggagcggcccttactatgtaaaagttgaatacctcggagaagaagaaccagag
gacggcggaacggcagaagcagctgcagaagccaagtatacgattgggtataaaggcacc
aaaaaacagccgtcagatttagaagaggaagaagcttgtccggttgaaatgagtgtcgat
cagaagaaatcaggaaaaggcatcctggataagttgagatcgattcgtgatgagcagctg
agccaaacagcagaaggcaaagaactgacaagcctttattacaaagcagcaccgtttatc
gttgcaaagctcgcactcaataaaacagcaagaaatgaaatctatcaggatcttgtgaca
ttaaagccgttatttgacgatgtgtcagaaaacggagcatcatcttcgtataaggtcact
gaaaaggatcaaaaagcgatcaaccggctatatgataaagctttacaatcagtcccgtca
ttccttaaagaggagataaagaaacaagcggaccgactaaatatgaagcagctgcaaggc
aaaacagcaggagccattttaacagaaaacaatattgcagcaaaaagtgaagttcagaca
acaaaggttattttcaaggtgaaggacaataaaagcctctcatccgtacataatgaaatg
aagggcttttctgcaagcgcgcaatcgaaaaaagacatatctaatgtgaaaaaggcaaag
aaactgtttgacaatctgtattcatttgaacttccgaaagacgagaaacagaacggcgca
tatacggcaagcgccaaaagggtcaaaagcgctgctgcgacactatccaagatgtccaat
gtagagtttgcggaacccgtacaggaatacaaaagcttggcaaacgatattcagtaccct
tatcaatggccgcttaaaaacaacggtgaaaacggcggtgtcaaaaatgcggatgtgaaa
tatgagcctgccaacacattgctgtccaaacgcaagcttaacgatacactcattgcagta
gtagacacaggcgtagacagcacgcttgccgatttaaaaggaaaagtaagaacagatctc
ggacacaattttgtcggacgaaataacaatgcaatggatgatcaggggcatgggacgcat
gtcgcaggcattattgcagcccaaagcgataacggctattcaatgactggattgaatgcc
aaagcaaaaatcatccctgtaaaagtgcttgattccgcaggttccggagatactgaacaa
attgctctcggcatcaaatatgctgctgacaaaggagcaaaggtgattaatttaagttta
ggcggaggctacagccgcgtgcttgaatttgctttgaagtacgcagctgacaaaaatgtc
ttgattgccgcagccagcgggaatgatggagaaaatgccttatcttatcctgcatcttct
aaatatgtgatgtcagtcggcgcaacgaatcgcatggatatgaccgctgatttctctaac
tatggaaaaggtctggacatctctgctccagggtctgatatcccgagcttagtgccgaac
ggaaatgtcacgtacatgagcggaacgtctatggcgacgccatatgctgccgccgctgcg
ggactgctgtttgctcaaaatcctaagctaaaaagaacagaagttgaggatatgttgaaa
aagacggcagatgatatttcctttgaaagtgtcgatggcggagaagaagagttgtatgac
gattatggcgatccgattgaaattccgaagacacctggtgtagactggcattcaggctac
gggcggctgaatgtcatgaaggctgtcagcgcagctgatttacagcttaaggtcaacaag
ctggaaagcactcaaacagctgtcagaggaagcgcgaaggaaggcacccttatcgaggtg
atgaacggcaaaaagaaactcggcagcgccaaagccggaaaagacaatgcgttcaaggtg
aatatcgcgactcaaaaacaggatcaagtactgtatctgaaagcaacaaaaggcgatgcg
aaaacatcgtataaagttgttgtcgtcaaaggaaaaccttccggcacaccgaaagtaaac
gcggtgaaaacgaaggatacggcagtaaaagggaaggcaaacagcaaagcgatgatcaga
gtgaaaaacaaatcaaagaaagtcattgcttctgccaaagctgacgcaaaaggaacgttt
tcggtgaaaatcaaaaaacaaaaagccggaacggtgctgtacgtcacggctgtggataca
gataaaaaagaaagcaaggaagcaaaagttgttgttgaaaagtaa

DBGET integrated database retrieval system