KEGG   Bacillus subtilis subsp. subtilis 168: BSU10900
Entry
BSU10900          CDS       T00010                                 

Gene name
yisY
Definition
(RefSeq) AB hydrolase superfamily protein YisY
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Abhydrolase_2 FSH1 Abhydrolase_4 Thioesterase Abhydrolase_5 DLH Peptidase_S15 Peptidase_S9 DUF1057 Ndr DUF3530 TPR_15
Other DBs
NCBI-GeneID: 939790
NCBI-ProteinID: NP_388971
Pasteur: BG13104
BSORF: BG13104
UniProt: O06734 A0A6M3ZCS3
LinkDB
Position
1169043..1169849
AA seq 268 aa
MGHYIKTEEHVTLFVEDIGHGRPIIFLHGWPLNHKMFEYQMNELPKRGFRFIGVDLRGYG
QSDRPWEGYDYDTMADDVKAVIYTLQLENAILAGFSMGGAIAIRYMARHEGADVDKLILL
SAAAPAFTKRPGYPYGMRKQDIDDMIELFKADRPKTLADLGKQFFEKKVSPELRQWFLNL
MLEASSYGTIHSGIALRDEDLRKELAAIKVPTLILHGRKDRIAPFDFAKELKRGIKQSEL
VPFANSGHGAFYEEKEKINSLIAQFSNS
NT seq 807 nt   +upstreamnt  +downstreamnt
atggggcattacatcaaaaccgaggagcatgtgacactgtttgtagaggatatcggacat
ggaaggccgatcatctttttgcacgggtggccgttgaatcataagatgtttgaatatcaa
atgaatgagcttccgaaaaggggatttcgttttatcggcgttgatttgcggggatatggg
caatctgaccgcccttgggaaggctacgattatgacacgatggccgatgatgtgaaagca
gtcatttatacgctgcagcttgagaatgcgattcttgccggtttttcaatgggcggcgca
attgcaatccgttatatggcaaggcatgaaggagccgatgttgataagctgattttactg
tctgcggcggcccccgcgtttacaaaacgcccgggttatccgtacgggatgaggaagcag
gatattgacgatatgattgaattgttcaaagctgatcggcccaaaacactggctgattta
gggaaacagttttttgagaaaaaagtgtctccagagcttaggcagtggtttctcaatctg
atgctggaggcttcctcctacgggacgatccactcgggcatcgcattaagagacgaagat
ctcagaaaggaacttgctgcaatcaaggtgccgacgctgatcctgcacgggagaaaggat
agaattgcgccgtttgattttgcgaaagaattgaagcgcggcatcaaacagtcggaattg
gttccgtttgcaaacagcgggcacggagcattttatgaggaaaaagagaagatcaacagt
ttgattgcgcagttctccaactcataa

DBGET integrated database retrieval system