KEGG   Bacillus subtilis subsp. subtilis 168: BSU10980Help
Entry
BSU10980          CDS       T00010                                 

Gene name
yitG
Definition
(RefSeq) MFS transporter
  KO
K08221  MFS transporter, ACDE family, multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU10980 (yitG)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Putative aromatic compound/drug exporter (ACDE) family [TC:2.A.1.32]
    BSU10980 (yitG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 Sugar_tr MFS_1_like TRI12
Motif
Other DBs
NCBI-GeneID: 939791
NCBI-ProteinID: NP_388979
Pasteur: BG13112
BSORF: BG13112
UniProt: Q796Q1
LinkDB All DBs
Position
complement(1175985..1177253)
Genome map
AA seq 422 aa AA seqDB search
MESSKQNNGMTIVAIGSIPLILTLGNSMLIPILPKMKSELHLSQFQVSLVITVFSLIAAF
AIPIVGYLADRFSRKVIIIPCLILYGAGGLLAGFAAGFFDNAYPWVMAGRALQGIGAAGT
GPIAMALTGDLFKGAQESKVLGLVEASNGMGKVLSPIIGSLIALLVWYGAFFAFPVFCII
SIVLTWIFIKEKKKEKEPPPIGQYAKGLLSVFKHEGRWLFTAYLAGATCLFTLFGILFYL
SDVLEKTYDTDGVKKGLILAIPLLVMCVTSYTTGSKIGQKQSLMKKLIVLGLAFMTVSYA
ALSFIENLVLFISVLVLSSIGSGLVLPCVNSFITGAVGKERRGFVTSLYGSVRFLGVAIG
PPIFGRLMQWSRPGMFLSIAGLTLVVGILVMMLIHVKQNNEETKEKEDPKMAGNRLQPAE
ER
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatcaaaacaaaataacggaatgacgattgtggcaatcggttcaatcccttta
atattaaccctaggaaactcgatgcttattccgattttgccaaaaatgaaatctgaactt
catttatcacaatttcaagtcagtctcgtgatcacagtattttccttgattgcagcattt
gcgattccgattgtcggttatctcgcagaccgattctcaaggaaagtcatcattattccc
tgcttaattttgtatggtgccggcggtttgttagccgggtttgcggcaggtttttttgac
aatgcctatccttgggtcatggcaggacgagcgttacagggaatcggggcagccggaacc
ggcccaattgccatggcactgacgggagatctgtttaaaggcgcccaggagagcaaggtg
ctcggccttgttgaagcttcaaacggcatggggaaagtgctatcgccgatcattggctcg
ctgatcgccctgcttgtctggtatggcgcgttttttgcctttcctgtgttttgtatcatt
tcgatcgtactgacttggatttttattaaagaaaagaaaaaggaaaaagaaccgccacca
atcggacaatatgcaaaagggctgttaagtgtctttaaacatgaaggcagatggctgttt
accgcttatttagccggtgcgacctgtttgtttactttattcggcatcctgttttatctc
tcagatgttcttgaaaaaacatacgacaccgacggcgtgaaaaaaggcttaattttagcg
atcccgcttttggttatgtgtgtgacgtcctatacaacaggaagcaaaatcgggcaaaag
caatcgttaatgaaaaagctgatcgtacttggattggcgttcatgaccgtatcctacgcg
gcactgtcattcattgaaaatcttgtcctttttatcagtgttcttgtactgagcagtata
ggctcaggtcttgtccttccttgtgtgaacagtttcattaccggggctgtcggcaaagaa
agacggggatttgtcacctcgctgtacggctctgtacgtttcttaggggtagcgatcggt
cctccgattttcggccgcctgatgcaatggtccagacccggcatgtttttaagcatcgcg
ggattgactctcgttgtcgggattcttgtgatgatgctcatccatgtgaagcaaaacaat
gaagaaacaaaagaaaaagaagaccctaaaatggctggcaatcggctccagcccgctgag
gaaaggtag

DBGET integrated database retrieval system