KEGG   Bacillus subtilis subsp. subtilis 168: BSU11090
Entry
BSU11090          CDS       T00010                                 

Gene name
yitR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3784 CPP1-like Tetraspanin
Other DBs
NCBI-GeneID: 939798
NCBI-ProteinID: NP_388990
Pasteur: BG13123
BSORF: BG13123
UniProt: O06753 A0A6M4JGT8
LinkDB
Position
1185608..1185901
AA seq 97 aa
MEISINYLLIVIALLFFVVAYFVGIKKQTWMLAGFNEARIRDKDRLARIAGYFFLNSGLF
ILLNSFISFQGQEQLIPPLILAYGAGVIIYVNKKLVE
NT seq 294 nt   +upstreamnt  +downstreamnt
atggaaatcagcatcaattatctattaattgtcatcgcgcttttattctttgtggttgcc
tattttgtcggaatcaaaaaacaaacctggatgttggctgggtttaacgaggcgcgtata
cgggataaagatcggctggccagaatagcaggctactttttcttgaattccggtttgttc
attttgctgaatagttttatctcatttcaaggtcaggagcagctcatacctccgcttata
ctggcatatggagcaggggttattatttatgtcaataaaaaattagtagagtag

DBGET integrated database retrieval system