KEGG   Bacillus subtilis subsp. subtilis 168: BSU11250
Entry
BSU11250          CDS       T00010                                 

Gene name
argF
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU11250 (argF)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     BSU11250 (argF)
SSDB
Motif
Pfam: OTCace OTCace_N THF_DHG_CYH_C Glyco_hydro_101
Other DBs
NCBI-GeneID: 936386
NCBI-ProteinID: NP_389007
Pasteur: BG10197
BSORF: BG10197
UniProt: P18186 A0A6M3Z9C7
LinkDB
Position
1203461..1204420
AA seq 319 aa
MHTVTQTSLYGKDLLTLKDLSEEDINALLAEAGELKQNKIQPIFHGKTLAMIFEKSSTRT
RVSFEAGMAQLGGSALFLSQKDLQLGRGETVADTAKVLSGYVDAIMIRTFEHEKVEELAK
EADIPVINGLTDKYHPCQALADLLTIKEIKGKLKGVKVAYIGDGNNVAHSLMIGCAKMGC
DISIASPKGYEVLDEAAEAAKTYALQSGSSVTLTDDPIEAVKDADVIYSDVFTSMGQEAE
EQERLAVFAPYQVNAALVSHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQAENRLH
VQKALLKAILYKGESSKNC
NT seq 960 nt   +upstreamnt  +downstreamnt
atgcacacagtgacgcaaaccagtttatacggaaaagatttattaacgttaaaggacctt
agtgaagaagatataaacgccttgctcgcagaagccggtgagctgaaacaaaacaaaatt
cagcctatattccatggcaaaaccttggcgatgatttttgaaaaatcatcaacgcggacc
cgtgtttcatttgaagcgggcatggcgcagctgggcgggagcgccctctttctaagccag
aaagatctgcagctggggcgcggtgagactgtcgctgatacggcaaaagtgctgtcaggc
tatgtggatgccatcatgatccggacctttgaacatgaaaaggtggaggaacttgccaaa
gaagctgacattccggtgatcaatggacttaccgataaataccacccatgccaggcgctg
gcggatctcttgacgattaaggagataaaagggaagcttaaaggcgtaaaagtcgcgtac
atcggtgacggaaataacgtggcgcactccttgatgatcggctgcgcgaaaatgggctgt
gatatctcgatcgcttcaccaaagggatatgaagtgttagatgaagcagctgaagcggca
aagacatatgcacttcaatccggctcttctgtcacgctgacagatgatccgattgaagct
gtaaaagacgcggacgtgatttattctgatgtgtttacaagcatggggcaggaagcggaa
gagcaagaacgtcttgctgtctttgcgccttatcaggtgaatgcggcgctggtcagccat
gccaagcctgactatacatttttacattgtctccctgcgcatcgcgaggaagaagtgact
gcggagattattgacgggccgaactctgcagtgttccagcaggcggaaaaccgtcttcat
gtgcaaaaagcactgctgaaggccattttatataaaggggaatcatcaaaaaactgctga

DBGET integrated database retrieval system