KEGG   Bacillus subtilis subsp. subtilis 168: BSU11540
Entry
BSU11540          CDS       T00010                                 

Gene name
pepF
Definition
(RefSeq) oligoendopeptidase F
  KO
K08602  oligoendopeptidase F [EC:3.4.24.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU11540 (pepF)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     BSU11540 (pepF)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M3
   BSU11540 (pepF)
SSDB
Motif
Pfam: Peptidase_M3 Peptidase_M3_N
Other DBs
NCBI-GeneID: 936404
NCBI-ProteinID: NP_389036
Pasteur: BG13136
BSORF: BG13136
UniProt: O31605
LinkDB
Position
1231083..1233095
AA seq 670 aa
MKGTKGKVFRVFTAFLAFVLFITAYDLTKGSEKPEDIHNTSLLRNSCFFNWLESKKTRGI
TMAEEKKANQLPDRSEVKAEDTWRLEDIFPSDEAWNKEFQAVKELIPNLSKYKGKLADSA
DHLYEALTYQDKVMERLGRLYTYAHMRSDQDTGNSFYQGLNDKAGNLYTQAASATAYLVP
EILSIEEDKLQQFILEKEELKLYSHAIEEITKERPHVLSEKEEALLAEASEVLGSSSNTF
SVLNNADITFPSIKDEDGNEKQITHGNFINFLESENREVRKNAFDAVYKTYGQYKNTMAT
TLSGTVKKDNFYARVKKYKSAREAALSNNSIPEEVYDNLVKTINKHLPLLHRYIALRKKV
LELDEVHIYDLYTPLVKDAGMKVTYEEAKDYMLKGLAPLGEEYASILKEGLENRWVDVYE
NKGKRNGAYSSGAYGTNPYILMNWHNNVNNLFTLVHEFGHSVHSYYTRKHQPYPYGNYSI
FVAEVASTTNEALLGEYLLNNLEDEKQRLYILNHMLEGFRGTVFRQTMFAEFEHLIHTKA
QEGEPLTPELLTNVYYDLNKKYFGDGMVIDKEIGLEWSRIPHFYYNYYVYQYATGYSAAQ
ALSSQILKEGKPAVDRYIDFLKAGSSQYPIDVLKKAGVDMTSPEPIEAACKMFEEKLDEM
EELLMKVKQS
NT seq 2013 nt   +upstreamnt  +downstreamnt
gtgaaaggcacaaaaggaaaggtttttcgtgtttttactgcttttttggcattcgttctc
ttcattactgcatatgatttgacaaaaggcagtgaaaaaccggaagatattcacaacaca
agtttattgagaaacagctgttttttcaattggcttgaatcaaagaagacgagggggatc
accatggctgaggaaaaaaaagcaaaccaactgcctgacagaagtgaggtaaaggcagaa
gacacatggagacttgaggatatttttcctagtgatgaggcctggaataaagaatttcaa
gctgtaaaagaattaattccgaatttatctaagtataaaggaaagctggcagattcagct
gatcatttatacgaggctcttacgtatcaagataaagtgatggagcggctaggtaggctg
tacacatatgcgcatatgcgctctgaccaggatactgggaactccttttaccaggggctg
aatgacaaggcgggaaacctgtatacacaggccgcaagcgcgacagcttatttggttccg
gagattttatccatagaagaagacaaactgcagcagttcattcttgaaaaagaagaattg
aagctgtactctcatgcgattgaggagattacaaaggaacgtccgcatgtgctgagcgag
aaggaagaggcgctgcttgctgaagcctccgaggtactggggtcatcttcaaatacattc
agcgtgttaaataacgcagatataacgtttccatccattaaagacgaagatgggaatgaa
aaacagatcactcacggcaactttattaatttcttggaaagtgaaaaccgtgaagtccgc
aaaaatgcgtttgacgcagtgtataaaacgtacggacaatataaaaacacaatggccacg
acgctaagcggcactgtgaaaaaggacaacttctacgcgagagtgaaaaagtacaagtcc
gcgcgtgaggctgcgctttctaacaacagtattcctgaggaagtatacgataaccttgtt
aagacgattaataagcatttgccgctcctgcaccgctatattgcgctaagaaagaaagtg
cttgagcttgatgaagtgcatatctatgacctgtatacaccgcttgtgaaagatgctggg
atgaaggtgacatacgaggaagccaaagattacatgctgaaaggcctcgcacctttaggg
gaagaatatgcctctatcctaaaagaaggactggaaaaccgctgggtggacgtttacgaa
aataaaggcaaacgcaatggggcttattcatcaggagcttacggcacgaatccgtatatt
ttgatgaactggcataataacgtcaataatctctttacgctcgtgcacgagtttggacat
tccgtacacagctactatacgagaaagcaccagccttatccatacggcaattacagcatc
tttgtcgcggaagttgcctctacgacaaatgaagcgctccttggcgaatatttgctgaac
aatttagaggatgaaaaacagcgcttatatattctcaaccatatgcttgagggcttcagg
ggaacggtcttcagacaaacgatgttcgctgaatttgaacatctgattcatacaaaggcg
caagaaggcgagccgcttacacctgagcttctgacaaatgtctattacgacctgaataaa
aagtattttggagacggcatggtgattgataaggaaatcggccttgaatggtcgcgtatt
ccgcacttctattacaattactatgtgtatcagtatgcgacaggttacagcgctgcccaa
gcattaagcagccagattttgaaggaaggaaagccggcggttgaccgttatattgacttc
ctgaaagcgggaagctcacaatacccgattgatgtcctgaaaaaagcgggtgttgatatg
acgtctccagagccaatcgaagccgcgtgcaaaatgtttgaagaaaaacttgatgaaatg
gaagagctgctgatgaaagtcaagcagtcttaa

DBGET integrated database retrieval system