KEGG   Bacillus subtilis subsp. subtilis 168: BSU12430
Entry
BSU12430          CDS       T00010                                 

Gene name
rapA
Definition
(RefSeq) response regulator aspartate phosphatase A
  KO
K06359  response regulator aspartate phosphatase A (stage 0 sporulation protein L) [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU12430 (rapA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU12430 (rapA)
SSDB
Motif
Pfam: RapH_N TPR_12 TPR_2 TPR_1 TPR_7 TPR_8 TPR_MalT TPR_19 TPR_10 TPR_6 Cohesin_load TPR_17 PPR RPN7 TPR_16 Foie-gras_1
Other DBs
NCBI-GeneID: 939417
NCBI-ProteinID: NP_389125
Pasteur: BG10652
BSORF: BG10652
UniProt: Q00828 A0A6M4JFA8
LinkDB
Position
1315869..1317005
AA seq 378 aa
MRMKQTIPSSYVGLKINEWYTHIRQFHVAEAERVKLEVEREIEDMEEDQDLLLYYSLMEF
RHRVMLDYIKPFGEDTSQLEFSELLEDIEGNQYKLTGLLEYYFNFFRGMYEFKQKMFVSA
MMYYKRAEKNLALVSDDIEKAEFAFKMAEIFYNLKQTYVSMSYAVQALETYQMYETYTVR
RIQCEFVIAGNYDDMQYPERALPHLELALDLAKKEGNPRLISSALYNLGNCYEKMGELQK
AAEYFGKSVSICKSEKFDNLPHSIYSLTQVLYKQKNDAEAQKKYREGLEIARQYSDELFV
ELFQFLHALYGKNIDTESVSHTFQFLEEHMLYPYIEELAHDAAQFYIENGQPEKALSFYE
KMVHAQKQIQRGDCLYEI
NT seq 1137 nt   +upstreamnt  +downstreamnt
ttgaggatgaagcagacgattccgtcctcttatgtcgggcttaaaattaatgaatggtat
actcatatccggcagttccacgtcgctgaagccgaacgggtcaagctcgaagtagaaaga
gaaattgaggatatggaagaagaccaagatttgctgctgtattattctttaatggagttc
aggcaccgtgtcatgctggattacattaagccttttggagaggacacgtcgcagctagag
ttttcagaattgttagaagacatcgaagggaatcagtacaagctgacagggcttctcgaa
tattactttaatttttttcgaggaatgtatgaatttaagcagaagatgtttgtcagtgcc
atgatgtattataaacgggcagaaaagaatcttgccctcgtctcggatgatattgagaaa
gcagagtttgcttttaaaatggctgagattttttacaatttaaaacaaacctatgtttcg
atgagctacgccgttcaggcattagaaacataccaaatgtatgaaacgtacaccgtccgc
agaatccaatgtgaattcgttattgcaggtaattatgatgatatgcagtatccagaaaga
gcattgccccacttagaactggctttagatcttgcaaagaaagaaggcaatccccgcctg
atcagttctgccctatataatctcggaaactgctatgagaaaatgggtgaactgcaaaag
gcagccgaatactttgggaaatctgtttctatttgcaagtcggaaaagttcgataatctt
ccgcattctatctactctttaacacaagttctgtataaacaaaaaaatgacgccgaagcg
caaaaaaagtatcgtgaaggattggaaatcgcccgtcaatacagtgatgaattatttgtg
gagctttttcaatttttacatgcgttatacggaaaaaacattgacacagaatcagtctca
cacacctttcaatttcttgaagaacatatgctgtatccttatattgaagagctggcgcat
gatgctgcccaattctatatagaaaacggacagcccgaaaaagcactttcattttatgag
aaaatggtgcacgcacaaaaacaaatccagagaggagattgtttatatgaaatctaa

DBGET integrated database retrieval system