KEGG   Bacillus subtilis subsp. subtilis 168: BSU12620
Entry
BSU12620          CDS       T00010                                 

Symbol
xkdH
Name
(RefSeq) phage-like element PBSX protein XkdH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3599
Other DBs
NCBI-GeneID: 936470
NCBI-ProteinID: NP_389144
Pasteur: BG11543
BSORF: BG11543
UniProt: P54328 A0A6M3ZA36
Structure
LinkDB
Position
1330892..1331248
AA seq 118 aa
MSYRQMLIHRCDIYHEAAQAPSAGRFGIPADRLQPVISYPDTPDEQDVPCYFTEKTQQLI
QEEPDQTVYHSFLVHFPLSADIRVNDKIIWENHKYILKLPKRIRHHHWEVVAVRDESL
NT seq 357 nt   +upstreamnt  +downstreamnt
atgagctacaggcagatgctcattcaccgctgcgatatttatcatgaagcagcgcaagcg
ccgtctgcaggccgatttgggattccggcagacaggctgcagccggtgatttcatatccg
gatacacccgatgaacaagatgtcccttgttattttaccgaaaaaacacagcagctgatt
caggaggagccggatcaaactgtatatcatagctttctcgtccattttccgttgtcagcg
gacatccgcgtgaacgataaaatcatttgggagaatcataaatatatactaaagctgccg
aaaaggatcagacatcatcattgggaggtcgtcgcagtcagggatgaaagcctatga

DBGET integrated database retrieval system