KEGG   Bacillus subtilis subsp. subtilis 168: BSU12780
Entry
BSU12780          CDS       T00010                                 

Symbol
xepA
Name
(RefSeq) phage-like element PBSX protein XepA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938161
NCBI-ProteinID: NP_389161
Pasteur: BG10959
BSORF: BG10959
UniProt: P39797 A0A6M3Z9S6
LinkDB
Position
1345839..1346678
AA seq 279 aa
MVKYQYEFPLDKAGKAGAVKPYRGGKNDFVTPVSNLSGVAEILTNAALKATEAYSQLGQD
RLGAVLISKVKGWAYADREGTLFIEESDNNNVWTTTAAVNVAAGVLTATDWVYLSKRYYR
FRYVNGNLQQSEFVLYQSVGAGEMDVRVNEKTPLQIDFAENQTHDGRLKVEARKTFDFVF
HENAESASEGAALPVDGAAHLLVEVYGTAEMSEVKFWGKSVSGQKLPIRGVKTDDATTAS
STLGKAEAWAFDIKGFKEIIMEIISITGGTLSVKGTAVS
NT seq 840 nt   +upstreamnt  +downstreamnt
atggtgaagtatcaatatgaatttcctctcgataaggctggaaaagccggcgctgtaaag
ccctatcgaggaggaaaaaatgattttgtgacacctgtttcgaatttgtcaggcgtagcg
gagattttaacaaatgctgctttaaaggcgactgaggcatacagtcagctcgggcaggac
aggcttggcgcagttctgatttcgaaagtgaagggctgggcgtatgcagatcgtgaaggt
acgctctttatagaagaaagcgacaacaacaatgtttggacaacgacagcagcagttaat
gtcgcagcaggcgtcctgacagcgacggactgggtatatctttctaaacgctattaccgt
ttccgctatgtgaacgggaatcttcagcaatctgagtttgtattataccaatcagtcggt
gcgggtgagatggatgtgcgtgtcaatgaaaaaacgcctttacagattgactttgcggag
aatcaaacacacgatggacggctgaaagtcgaggctcgcaaaacatttgactttgtcttt
catgaaaatgcagagtccgccagcgagggggctgctttacctgttgacggtgccgcgcat
ttactcgttgaagtctacggcacagcagaaatgagcgaagtcaaattttggggcaaatcg
gtgtcaggacagaaactgccgatcagaggcgtgaaaactgatgatgctaccactgcctcc
agtacattaggaaaagctgaggcatgggcctttgatattaaagggtttaaggagatcatc
atggagattatcagtatcaccggcggtactctttcggtaaaagggaccgcggtttcataa

DBGET integrated database retrieval system