KEGG   Bacillus subtilis subsp. subtilis 168: BSU12870
Entry
BSU12870          CDS       T00010                                 

Symbol
mhqA
Name
(RefSeq) ring-cleaving dioxygenase MhqA
  KO
K15975  glyoxalase family protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    BSU12870 (mhqA)
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4
Other DBs
NCBI-GeneID: 936149
NCBI-ProteinID: NP_389170
Pasteur: BG13228
BSORF: BG13228
UniProt: O34689 A0A6M3Z9T6
LinkDB
Position
1353080..1354030
AA seq 316 aa
MKVNGIHHVSALTADAQKNLDFYKKVLGLKLVKKSVNQDEPTMYHLFYGDEVANPGTELT
FFEIPRIAPFHAGTNSISSIGLRVPGTEALHYWKERFEEQQVTHSGISKRAGRDILAFQD
HEGQRLVLTADEEGKGYGLPVKQSGIPEEFSFRGLGPVELTVPYAEPTLHVLTNILGFTE
ISREPVEGQGTAVILESGEGGAATEIHLIERNDLPRERQGKGSVHHVAFRVRDEEELAGW
HRIISREGFSNSGIVERYYFKALYFREPNGILFELSTDGPGFMVDENLDELGQTIALPPY
LEHRRAEIEAKLKPIQ
NT seq 951 nt   +upstreamnt  +downstreamnt
atgaaagttaacggcattcaccacgtatcggcattaacggccgacgcacaaaaaaacttg
gatttctataagaaagtattaggattaaagctcgtcaaaaaatccgtcaatcaggatgaa
ccgacaatgtaccatctgttctacggagatgaagtggcaaacccgggaactgagctgacg
tttttcgagattccccgcattgcaccgtttcatgcgggaacaaacagtatttcttctatt
ggattgcgcgttccaggcacagaagccctgcattactggaaagaacgttttgaagagcag
caagtaacgcacagcggcatctccaaaagagccggacgtgacatattggcatttcaagat
catgaggggcagcgacttgtgctgactgctgatgaggaaggaaaaggatatggcctgcct
gttaaacagagcggcattccggaagaattttcgtttcgcgggttagggccggttgaactg
actgtgccatatgctgaaccaactttacacgtattgacgaatattcttggatttacagaa
atcagccgtgaaccagtcgaagggcaaggaaccgccgttattctggaatcaggagaaggc
ggtgctgcaacggaaatccatttaatagaaagaaacgatcttccgcgagagcgtcaaggc
aaagggagtgttcaccacgtcgcatttcgggtaagagatgaagaagaacttgccgggtgg
caccggatcatcagccgcgaaggctttagcaattcaggcatagttgagcgctactatttc
aaggcgctgtatttcagagaaccgaacggcattttgttcgagttatcaacagacggaccg
ggctttatggtagatgaaaatcttgatgagcttggccaaacgattgctcttccgccatat
ctagagcatcgaagagcagaaattgaagcaaaattgaaaccgatccaataa

DBGET integrated database retrieval system