KEGG   Bacillus subtilis subsp. subtilis 168: BSU13000
Entry
BSU13000          CDS       T00010                                 
Symbol
ykfD
Name
(RefSeq) oligopeptide transport ATP-binding protein YkfD
  KO
K02032  peptide/nickel transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU13000 (ykfD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13000 (ykfD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BSU13000 (ykfD)
SSDB
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 AAA_5 AAA_16 AAA_29 AAA RsgA_GTPase DUF5906 AAA_13 AAA_18 ATP-synt_ab
Other DBs
NCBI-GeneID: 939863
NCBI-ProteinID: NP_389183
Pasteur: BG13234
BSORF: BG13234
UniProt: C0SP98 A0A6M4JHB4
LinkDB
Position
1368844..1369833
AA seq 329 aa
MRRLPLLEVSQLKMHFDAGKKRTVKAVDGVTFQIREGETFGLVGESGCGKSTLGRVLMRL
YQPTEGSVTYRGTNLHALSEKEQFAFNRKLQMIFQDPYASLNPRMTVREIILEPMEIHNL
YNTHKARLLVVDELLEAVGLHPDFGSRYPHEFSGGQRQRIGIARALSLNPEFIVADEPIS
ALDVSVQAQVVNLLKRLQKEKGLTFLFIAHDLSMVKHISDRIGVMYLGHMMEITESGTLY
REPLHPYTKALLSSIPIPDPELEDKRERILLKGELPSPVNPPSGCVFRTRCPEAMPECGE
SRPQLQEIEPGRFVACHLYRNAETKEKVR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaggcgactgcctttgttagaggtcagccagctgaaaatgcattttgacgcagggaaa
aagcggacagtcaaagctgtcgacggggtcacctttcagattcgtgaaggagaaacgttc
gggctagtcggggaatcagggtgcgggaaatcaaccttggggagagtgctgatgcgcctt
tatcagccgacagaaggaagcgtgacataccgcggcacaaatcttcatgcactaagtgaa
aaagagcagtttgccttcaaccgcaaactgcagatgatttttcaggacccttatgcttca
cttaacccgcgcatgaccgttcgagaaattattttggagccgatggagattcataatctc
tacaatacccataaagcacggcttctcgtcgtggacgagctgcttgaggcagttgggctt
caccccgattttggcagccgttatccgcatgaattcagcggcgggcaaaggcagagaatc
gggattgcgagagcactgtcgctgaatcctgaatttatcgtggcggacgaaccgatttct
gcacttgatgtctctgttcaagcgcaggtggtcaacctgctgaagcggcttcaaaaagag
aaagggcttacgtttttattcattgcccatgatctttcgatggtgaagcatatcagtgac
aggatcggtgttatgtacttaggacacatgatggaaattacagagagcggcaccttgtat
cgtgaaccgctccatccctatacaaaggcgcttttgtcctcgattccgattccagatcct
gaattggaggacaagcgtgagcgtattctcttgaaaggggagctgccgagcccggtcaat
ccgccaagcggctgcgtgtttcgtacccgctgtccggaggcgatgcctgaatgtggagaa
tctcgtccccagcttcaagaaatcgaacccggccgttttgtcgcttgccatttgtatcga
aatgctgaaacgaaggaaaaagtaagataa

DBGET integrated database retrieval system