KEGG   Bacillus subtilis subsp. subtilis 168: BSU13110
Entry
BSU13110          CDS       T00010                                 

Gene name
purU
Definition
(RefSeq) formyltetrahydrofolate deformylase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU13110 (purU)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU13110 (purU)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     BSU13110 (purU)
SSDB
Motif
Pfam: Formyl_trans_N ACT ACT_6
Other DBs
NCBI-GeneID: 939854
NCBI-ProteinID: NP_389194
Pasteur: BG13237
BSORF: BG13237
UniProt: O34990 A0A6M3Z9Y6
LinkDB
Position
1377243..1378145
AA seq 300 aa
MKSYMTQRLDEYRDGNEDKGRLLVSCPDQPGIVSAVSAFLFEHGANIIESNQYTTDPEGG
RFFLRIEFDCAGIREKKSSLQAAFASVAEKFDMTWSLTLASELKRVAIFVSKELHCLHEL
IWEWQTGNLMAEIAVVISNHEEARELVERLNIPFHYMKANKDIRAEVEKKQLELLEQYDV
DVIVLARYMQILTPDFVSAHPNRIINIHHSFLPAFIGANPYKRAYERGVKLIGATSHYVT
NDLDEGPIIEQDIERVDHRDNAEALKNIGRTIERSVLARAVKWHLEDRVIVHENKTIVFN
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaaatcatatatgactcagcggttggacgaataccgtgacggaaatgaggataaaggt
cggctcttggtcagctgccccgatcagccgggtatcgtctctgcagtttccgcgttttta
tttgaacacggtgccaatattatagaatcaaatcaatatacgacagaccctgaaggcggc
cggttcttcctgagaatcgaattcgactgcgcaggcattcgtgaaaaaaaatcatcactt
caggcagcgtttgcctctgttgcggaaaaattcgacatgacatggagcttaactttggcg
agcgaactgaagcgtgtcgccattttcgtttcaaaggagctccactgcctgcatgagctg
atttgggaatggcaaaccggcaacctgatggcggagatcgctgttgtcatcagtaaccat
gaggaagcgagagagctggttgagcgcctgaacattccattccactatatgaaagcgaac
aaagacatcagagcggaagtcgaaaagaagcagcttgaactgctggagcagtacgatgtt
gatgtgatcgtgctcgcacgctatatgcagattctaactcctgattttgtttcggctcat
ccgaatcgcatcatcaatatccaccattcattcctgccagcttttatcggtgcgaatccg
tacaaacgggcctacgagcgcggcgtgaaactgatcggtgcgacatctcattatgtgaca
aacgatcttgatgaagggccgatcattgaacaggatattgagcgtgtggaccaccgcgat
aatgcggaagcgctgaaaaacatcggaagaacaattgagcgcagcgtgcttgcccgtgct
gtgaaatggcatttggaagaccgtgtcatcgttcatgaaaataaaacaatcgtctttaac
tag

DBGET integrated database retrieval system