KEGG   Bacillus subtilis subsp. subtilis 168: BSU13190
Entry
BSU13190          CDS       T00010                                 

Symbol
ispA
Name
(RefSeq) major intracellular serine protease
  KO
K13275  major intracellular serine protease [EC:3.4.21.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU13190 (ispA)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU13190 (ispA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BSU13190 (ispA)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S8: subtilisin family
   BSU13190 (ispA)
Chaperones and folding catalysts [BR:bsu03110]
 Intramolecular chaperones
  Subtilisin family
   BSU13190 (ispA)
SSDB
Motif
Pfam: Peptidase_S8 Peripla_BP_4
Other DBs
NCBI-GeneID: 939934
NCBI-ProteinID: NP_389202
Pasteur: BG10674
BSORF: BG10674
UniProt: P11018 A0A6M3Z9W4
LinkDB
Position
complement(1386024..1386983)
AA seq 319 aa
MNGEIRLIPYVTNEQIMDVNELPEGIKVIKAPEMWAKGVKGKNIKVAVLDTGCDTSHPDL
KNQIIGGKNFTDDDGGKEDAISDYNGHGTHVAGTIAANDSNGGIAGVAPEASLLIVKVLG
GENGSGQYEWIINGINYAVEQKVDIISMSLGGPSDVPELKEAVKNAVKNGVLVVCAAGNE
GDGDERTEELSYPAAYNEVIAVGSVSVARELSEFSNANKEIDLVAPGENILSTLPNKKYG
KLTGTSMAAPHVSGALALIKSYEEESFQRKLSESEVFAQLIRRTLPLDIAKTLAGNGFLY
LTAPDELAEKAEQSHLLTL
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaatggtgaaatccgcttgatcccgtatgtgacgaatgagcagatcatggatgtaaac
gagcttcctgagggcattaaagtgattaaggcgccagaaatgtgggcaaaaggggtaaaa
ggcaaaaatattaaagttgctgtattagacacaggctgcgacacaagccaccctgattta
aaaaatcaaatcatcggcggaaagaacttcacggatgacgacggcggcaaggaagatgcg
atttccgactacaacggacacggcacacacgtcgccggaacaattgcagctaatgattca
aacggaggcattgccggagtcgcgcctgaggcaagcctattgattgtgaaggttcttggc
ggcgagaacggcagcggacaatacgaatggataattaacggcatcaactacgcggtggaa
cagaaagtcgacatcatctcaatgtcccttggagggccaagcgatgtgccagagctaaaa
gaagcagtgaaaaacgcagtgaaaaacggagtgcttgtcgtttgtgcagcgggaaatgaa
ggtgacggcgacgaacgcacagaagagctttcctaccccgcagcttataatgaagtgatt
gcagttggatctgtttctgtagcgcgagaattatcagaattttctaacgcgaataaagag
attgaccttgtggcaccaggagaaaacatcttatccacccttcccaacaagaagtacggt
aagctgaccggcacttcaatggctgcccctcatgtcagcggtgcgcttgctttaatcaaa
agctatgaagaagaatcatttcaaagaaagctttctgaatctgaggttttcgcacagcta
atccgcaggacacttcctcttgatattgcaaaaacgctggcaggcaatggattcctgtat
ttaacagctcctgatgagctcgcagaaaaagcagagcaatcacatttgttgaccctataa

DBGET integrated database retrieval system