KEGG   Bacillus subtilis subsp. subtilis 168: BSU13840
Entry
BSU13840          CDS       T00010                                 
Symbol
stoA
Name
(RefSeq) sporulation thiol-disulfide oxidoreductase A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AhpC-TSA Redoxin Thioredoxin_8 Thioredoxin Thioredoxin_2 Thioredoxin_9 QSOX_Trx1 DUF953 TraF
Other DBs
NCBI-GeneID: 936262
NCBI-ProteinID: NP_389267
Pasteur: BG13324
UniProt: O31687 A0A6M3ZAI0
Structure
LinkDB
Position
1450638..1451135
AA seq 165 aa
MLTKRLLTIYIMLLGLIAWFPGAAQAEEKQPAVPAVFLMKTIEGEDISIPNKGQKTILHF
WTSWCPPCKKELPQFQSFYDAHPSDSVKLVTVNLVNSEQNQQVVEDFIKANKLTFPIVLD
SKGELMKEYHIITIPTSFLLNEKGEIEKTKIGPMTAEQLKEWTEE
NT seq 498 nt   +upstreamnt  +downstreamnt
atgttgacgaagcgcttgcttactatatacattatgttattagggttgattgcatggttt
ccaggtgcggcacaagctgaggaaaaacagcctgctgttcccgctgtttttcttatgaaa
acgatagaaggggaggacatctcgattccgaataaagggcaaaaaacaattctccatttt
tggacgtcatggtgcccgccctgcaaaaaggagcttccacagtttcaatcgttttatgat
gcccatccatccgacagtgtaaagctggtaacggtgaatttagtgaattcggaacaaaat
cagcaagtcgttgaagactttattaaagcaaacaagctgacgtttccgattgtccttgac
tcaaaaggggaattgatgaaggagtatcatatcatcacgatcccaacatcatttttgctg
aatgaaaagggagaaattgaaaaaacaaaaattggcccgatgacagcggaacaactgaag
gaatggacggaagaatag

DBGET integrated database retrieval system