KEGG   Bacillus subtilis subsp. subtilis 168: BSU15440
Entry
BSU15440          CDS       T00010                                 

Symbol
ylyA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: zf-dskA_traR
Other DBs
NCBI-GeneID: 938068
NCBI-ProteinID: NP_389427
Pasteur: BG11795
BSORF: BG11795
UniProt: Q45478 A0A6M3ZAK5
LinkDB
Position
1616267..1616641
AA seq 124 aa
MNDQLTAIYTELLLMKEELQSRLFEYSCFQVSTSPQAAINQKQKATLIYHIKEELQDVLL
ALSKIENGTFGYCEETGAPIPLAKLAVLPTARTANDFLYSVQFEKKTLPIWKSTDIEYGQ
ALYE
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaatgatcaactgaccgcaatttatacggaacttcttctgatgaaagaagaattacag
tcgagattatttgagtattcttgctttcaggtttctacaagcccgcaagcagcaatcaat
caaaaacaaaaagcaactctgatctatcatattaaagaagaacttcaagacgttctcctt
gcattgtccaaaatcgaaaacggcacattcggatactgtgaagaaactggggcccccatt
cctcttgcaaagctggcagtgctgccgacggcccgaacagcaaacgattttctttattct
gtccaatttgagaaaaaaacgcttccgatatggaaatcaacggatatcgaatatggtcag
gcactgtatgaataa

DBGET integrated database retrieval system