KEGG   Bacillus subtilis subsp. subtilis 168: BSU17180Help
Entry
BSU17180          CDS       T00010                                 

Gene name
pksJ
Definition
(RefSeq) polyketide synthase PksJ
  KO
K13611  polyketide synthase PksJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU17180 (pksJ)
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17180 (pksJ)
Lipid biosynthesis proteins [BR:bsu01004]
 Polyketide synthase
  Modular PKS
   BSU17180 (pksJ)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   trans-AT PKS
    Bacillaene PksX synthase
     BSU17180 (pksJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt AMP-binding Condensation Ketoacyl-synt_C KR PP-binding PS-DH KAsynt_C_assoc adh_short adh_short_C2 AMP-binding_C Thiolase_N AMP-binding_C_2 ACP_syn_III Polysacc_synt_2 AATase
Motif
Other DBs
NCBI-GeneID: 940043
NCBI-ProteinID: NP_389598
Pasteur: BG10929
BSORF: BG10929
UniProt: P40806
LinkDB All DBs
Structure
PDB: 

Position
1792806..1807937
Genome map
AA seq 5043 aa AA seqDB search
MRNNDNIRILTNPSVSHGEPLHISEKQPATIPEVLYRTATELGDTKGIIYLQPDGTEVYQ
SYRRLWDDGLRIAKGLRQSGLKAKQSVILQLGDNSQLLPAFWGCVLTGVVPAPLAVPPTY
AESSSGTQKLKDAWTLLDKPAVITDRGMHQEMLDWAKEQGLEGFRAIIVEDLLSAEADTD
WHQSSPEDLALLLLTSGSTGTPKAVMLNHRNIMSMVKGIIQMQGFTREDITFNWMPFDHV
GGIGMLHLRDVYLGCQEINVSSETILMEPLKWLDWIDHYRASVTWAPNFAFGLVTDFAEE
IKDKKWDLSSMRYMLNGGEAMVAKVGRRILELLEPHGLPADAIRPAWGMSETSSGVIFSH
EFTRAGTSDDDHFVEIGSPIPGFSMRIVNDHNELVEEGEIGRFQVSGLSVTSGYYQRPDL
NESVFTEDGWFETGDLGFLRNGRLTITGRTKDAIIINGINYYSHAIESAVEELPEIETSY
TAACAVRLGQNSTDQLAIFFVTSAKLNDEQMSQLLRNIQSHVSQVIGVTPEYLLPVQKEE
IPKTAIGKIQRTQLKTSFENGEFDHLLHKPNRMNDAVQDEGIQQADQVKRVREEIQKHLL
TCLTEELHVSHDWVEPNANIQSLGVNSIKMMKLIRSIEKNYHIKLTAREIHQYPTIERLA
SYLSEHEDLSSLSADKKGTDTYKTEPERSQATFQPLSEVQKGLWTLQKMSPEKSAYHVPL
CFKFSSGLHHETFQQAFGLVLNQHPILKHVIQEKDGVPFLKNEPALSIEIKTENISSLKE
SDIPAFLRKKVKEPYVKENSPLVRVMSFSRSEQEHFLLVVIHHLIFDGVSSVTFIRSLFD
TYQLLLKGQQPEKAVSPAIYHDFAAWEKNMLAGKDGVKHRTYWQKQLSGTLPNLQLPNVS
ASSVDSQFREDTYTRRLSSGFMNQVRTFAKEHSVNVTTVFLSCYMMLLGRYTGQKEQIVG
MPAMVRPEERFDDAIGHFLNMLPIRSELNPADTFSSFISKLQLTILDGLDHAAYPFPKMV
RDLNIPRSQAGSPVFQTAFFYQNFLQSGSYQSLLSRYADFFSVDFVEYIHQEGEYELVFE
LWETEEKMELNIKYNTGLFDAASISAMFDHFVYVTEQAMLNPSQPLKEYSLLPEAEKQMI
LKTWNATGKTYPYITFHELFEQQAKKTPDRAAVSYEGQTLTYRELDEKSTQLAIYLQAHG
VGPDRLAGIYVDRSLDMLVGLLAILKAGGAYVPLDPSYPAERLEYMLEDSEVFITLTTSE
LVNTLSWNGVTTALLDQDWDEIAQTASDRKVLTRTVTPENLAYVIYTSGSTGKPKGVMIP
HKALTNFLVSMGETPGLTAEDKMLAVTTYCFDIAALELFLPLIKGAHCYICQTEHTKDVE
KLKRDIRAIKPTVMQATPATWKMLFYSGWENEESVKILCGGEALPETLKRYFLDTGSEAW
NMFGPTETTIWSAVQRINVECSHATIGRPIANTQIYITDSQLAPVPAGVPGELCIAGDGV
AKGYYKKEELTDSRFIDNPFEPGSKLYRTGDMARWLTGGRIEYIGRIDNQVKIRGFRIEL
GDIESRLSEHPGILECVVVADMDNLAAYYTAKHANASLTARELRHFVKNALPAYMVPSYF
IQLDHMPLTPNGKIDRNSLKNIDLSGEQLKQRQTSPKNIQDTVFTIWQEVLKTSDIEWDD
GFFDVGGDSLLAVTVADRIKHELSCEFSVTDLFEYSTIKNISQYITEQRMGDASDHIPTD
PAAHIEDQSTEMSDLPDYYDDSVAIIGISCEFPGAKNHDEFWENLRDGKESIAFFNKEEL
QRFGISKEIAENADYVPAKASIDGKDRFDPSFFQISPKDAEFMDPQLRMLLTHSWKAIED
AGYAARQIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGTIPTMISHKLG
LRGPSYFVHANCSSSLIGLHSAYKSLLSGESDYALVGGATLHTESNIGYVHQPGLNFSSD
GHIKAFDASADGMIGGEGVAVVLLKKAADAVKDGDHIYALLRGIGVNNDGADKVGFYAPS
VKGQADVVQQVMNQTKVQPESICYVEAHGTGTKLGDPIELAALTNVYRQYTNKTQFCGIG
SVKTNIGHLDTAAGLAGCIKVVMSLYHQELAPSVNYKEPNPNTDLASSPFYVVDQKKTLS
REIKTHRAALSSFGLGGTNTHAIFEQFKRDSDKGKIDGTCIVPISAKNKERLQEYAEDIL
AYLERRGFENSQLPDFAYTLQVGREAMEHRVVFIADHVNELKQRLTDFINGNTAIEGCFQ
GSKHNAREVSWLTEDEDSAELIRKWMAKGKVNKLAEMWSKGAHIDWMQLYKGERPNRMSL
PTYPFAKERYWPSQDDRKPVAQISGNQTGIGSIHPLLHQNTSDFSEQKFSSVFTGDEFFL
RDHVVRGKPVLPGVAYLEMAYAAINQAAGSEIGQDVRIRLNHTVWVQPVVVDRHSAQVDI
SLFPEEDGKITFDIYSTQEDGDDPVIHSQGSAELASAAETPVADLTEMSRRCGKGKMSPD
QFYEEGRSRGMFHGPAFQGIKNVNIGNREVLAQLQLPEIVSGTNEQFVLHPSIMDSALQT
ATICIMQELTDQKLILPFALEELEVIKGCSSSMWAYARLSDSDHSGGVVQKADIDVIDES
GTVCVRIKGFSTRVLEGEVHTSKPSTRHERLMLEPVWEKQNEEREDEDLSYTEHIIVLFE
TERSVTDSIASHMKDARVITLNEAVGHIAERYQCYMQNIFELLQSKVRKLSAGRIIIQAI
VPLEKEKQLFAGVSGLFKTAEIEFSKLTAQVIEIEKPEEMIDLHLKLKDDSRRPFDKQIR
YEAGYRFVKGWREMVLPSADTLHMPWRDEGVYLITGGAGSLGLLFAKEIANRTGRSTIVL
TGRSVLSEDKENELEALRSIGAEVVYREADVSDQHAVRHLLEEIKERYGTLNGIIHGAGS
SKDRFIIHKTNEEFQEVLQPKVSGLLHVDECSKDFPLDFFIFFSSVSGCLGNAGQADYAA
ANSFMDAFAEYRRSLAASKKRFGSTISFNWPLWEEGGMQVGAEDEKRMLKTTGMVPMPTD
SGLKAFYQGIVSDKPQVFVMEGQLQKMKQKLLSAGSKAKRNDQRKADQDQGQTRKLEAAL
IQMVGAILKVNTDDIDVNTELSEYGFDSVTFTVFTNKINEKFQLELTPTIFFEYGSVQSL
AEYVVAAYQGEWNQDATAKGKDERTNLVHSLSSLEASLSNMVSAILKVNSEDIDVNTELS
EYGFDSVTFTVFTNKINEEFQLELTPTIFFEYGSLHSLAEYLTVEHGDTLVQEREKPEGQ
EELQTKSSEAPKITSRRKRRFTQPIIAKAERNKKQAADFEPVAIVGISGRFPGAMDIDEF
WKNLEEGKDSITEVPKDRWDWREHYGNPDTDVNKTDIKWGGFIDGVAEFDPLFFGISPRE
ADYVDPQQRLLMTYVWKALEDAGCSPQSLSGTGTGIFIGTGNTGYKDLFHRANLPIEGHA
ATGHMIPSVGPNRMSYFLNIHGPSEPVETACSSSLVAIHRAVTAMQNGDCEMAIAGGVNT
ILTEEAHISYSKAGMLSTDGRCKTFSADANGYVRGEGVGMVMLKKLEDAERDGNHIYGVI
RGTAENHGGRANTLTSPNPKAQADLLVRAYRQADIDPSTVTYIEAHGTGTELGDPIEING
LKAAFKELSNMRGESQPDVPDHRCGIGSVKSNIGHLELAAGISGLIKVLLQMKHKTLVKS
LHCETLNPYLQLTDSPFYIVQEKQEWKSVTDRDGNELPRRAGISSFGIGGVNAHIVIEEY
MPKANSEHTATEQPNVIVLSAKNKSRLIDRASQLLEVIRNKKYTDQDLHRIAYTLQVGRE
EMDERLACVAGTMQELEEKLQAFVDGKEETDEFFRGQSHRNKETQTIFTADEDMALALDA
WIRKRKYAKLADLWVKGVSIQWNTLYGETKPRLISLPSYPFAKDHYWVPAKEHSERDKKE
LVNAIEDRAACFLTKQWSLSPIGSAVPGTRTVAILCCQETADLAAEVSSYFPNHLLIDVS
RIENDQSDIDWKEFDGLVDVIGCGWDDEGRLDWIEWVQRLVEFGHKEGLRLLCVTKGLES
FQNTSVRMAGASRAGLYRMLQCEYSHLISRHMDAEEVTDHRRLAKLIADEFYSDSYDAEV
CYRDGLRYQAFLKAHPETGKATEQSAVFPKDHVLLITGGTRGIGLLCARHFAECYGVKKL
VLTGREQLPPREEWARFKTSNTSLAEKIQAVRELEAKGVQVEMLSLTLSDDAQVEQTLQH
IKRTLGPIGGVIHCAGLTDMDTLAFIRKTSDDIQRVLEPKVSGLTTLYRHVCNEPLQFFV
LFSSVSAIIPELSAGQADYAMANSYMDYFAEAHQKHAPIISVQWPNWKETGMGEVTNQAY
RDSGLLSITNSEGLRFLDQIVSKKFGPVVLPAMANQTNWEPELLMKRRKPHEGGLQEAAL
QSPPARDIEEADEVSKCDGLLSETQSWLIDLFTEELRIDREDFEIDGLFQDYGVDSIILA
QVLQRINRKLEAALDPSILYEYPTIQRFADWLIGSYSERLSALFGGRISDASAPLENKIE
AEASVPGKDRALTPQIQAPAILSPDSHAEGIAVVGLSCRFPGAETLESYWSLLSEGRSSI
GPIPAERWGCKTPYYAGVIDGVSYFDPDFFLLHEEDVRAMDPQALLVLEECLKLLYHAGY
TPEEIKGKPVGVYIGGRSQHKPDEDSLDHAKNPIVTVGQNYLAANLSQFFDVRGPSVVVD
TACSSALVGMNMAIQALRGGDIQSAIVGGVSLLSSDASHRLFDRRGILSKHSSFHVFDER
ADGVVLGEGVGMVMLKTVKQALEDGDIIYAVVKAASVNNDGRTAGPATPNLEAQKEVMKD
ALFKSGKKPEDISYLEANGSGSIVTDLLELKAIQSVYRSGHSSPLSLGSIKPNIGHPLCA
EGIASFIKVVLMLKERRFVPFLSGEKEMAHFDQQKANITFSRALEKWTDSQPTAAINCFA
DGGTNAHVIVEAWEKDEKHAIKRSPISPPQLKKRMLSPGEPKLEAETSKMTAANIWDTYE
VEV
NT seq 15132 nt NT seq  +upstreamnt  +downstreamnt
atgagaaataatgataatatccgcatattaactaatccttctgtcagtcatggggagcct
ttacatatatctgaaaagcagccggcaacaatacctgaagttttatacagaacggcgacg
gagcttggggatacaaagggaatcatttatttgcagccggatggaactgaagtttaccaa
tcatacagacgattatgggatgatggattgcgcattgcgaaggggcttcgccaatcaggc
ctgaaagcaaaacaaagcgtgattttgcagcttggtgacaattcacagcttctccctgcg
ttctgggggtgtgtgttaacaggggttgttccggctccattagccgttccgccaacgtat
gctgaatcgagcagcggcactcaaaagctgaaagacgcatggacgcttcttgataagcca
gcggtgattacggaccgggggatgcatcaggaaatgctcgattgggcaaaagaacaaggg
cttgaagggttcagggcaattattgtagaggatctgctcagcgctgaagcggacacagat
tggcatcaatccagtcctgaagacttagcgcttttattgctgacttcaggcagtacggga
acgcccaaagcagttatgcttaatcatcgtaacattatgagcatggtgaaagggattatt
caaatgcaaggcttcaccagagaggatattacgtttaactggatgccgtttgaccatgtc
ggagggatcggaatgctgcatttgcgggatgtttatcttggctgtcaggaaattaacgtc
tcaagcgaaacgatcttaatggagccgttgaaatggctggattggattgatcattaccga
gcttctgttacgtgggcgccgaattttgcgtttggtctggttactgattttgcagaagaa
ataaaagataagaaatgggatctgtcttcaatgcgatacatgctcaatggcggtgaagca
atggtagccaaggtagggcgtagaatacttgagcttttagaaccacatggactgcctgct
gacgccatccgacctgcctggggaatgtccgaaacttcatcgggcgttattttttctcat
gaatttacccgggctggaacaagtgatgatgatcattttgttgaaataggctctccaatc
cccggcttctctatgagaattgtgaatgaccataatgaattggttgaagagggtgagatc
ggccgttttcaagtctcgggtctttctgttactagcggttattaccagcggcctgatttg
aatgagagtgtgtttacagaagacggctggtttgaaaccggagatcttggctttttgcga
aacgggcgcttaaccataacaggccgtacgaaagatgcaattatcattaacggcattaat
tattacagtcatgcaattgagtctgcagttgaagaattacctgaaattgaaacttcttat
actgctgcttgcgctgtccgtctgggccagaattcaacagatcagctggctatcttcttt
gttacttccgcaaaattaaatgatgagcagatgtctcagcttcttagaaacatacaatcc
catgtctcacaggtgatcggagtcaccccggaatatttgctgcctgtacaaaaagaagag
attccaaaaacggctatcggaaagatccagcgcacccagctaaaaacttcatttgaaaat
ggagagttcgaccacttgctacataaacccaatcggatgaacgatgcagtccaggatgag
gggatacagcaagcagaccaggtgaaaagagtaagggaagaaatacagaagcatctgctc
acctgtttgactgaggagctgcacgtttcccacgattgggtggagccaaatgcaaatatc
caaagtcttggtgtgaattctatcaagatgatgaagctcattcgatcgatcgagaaaaac
tatcatatcaaactaacagctagagagatacatcaatatcctacaattgaacgcttagcc
agctatctatcagaacatgaagacctcagcagcttgtctgctgacaaaaagggcacggac
acatataaaaccgaaccggaaaggagtcaggcaacttttcagcctctctctgaggttcaa
aaaggattatggacattgcaaaaaatgtcacccgaaaaaagtgcatatcacgtacctctc
tgttttaaattttcgtcagggcttcaccatgaaacattccagcaggctttcggccttgta
ttgaatcagcacccaatcttaaagcacgtcatccaagagaaagacggagtgccatttctt
aaaaatgagccagcactttcaattgaaatcaagacagaaaatatctcaagtttgaaagag
tctgatattcctgcttttcttagaaagaaagtaaaggaaccgtatgtaaaggaaaacagc
ccgttagtgcgtgtcatgagcttttccagatctgaacaagagcattttttattagttgtc
attcaccatttgatttttgacggagtttcgtctgtcacatttatacgcagtctgtttgat
acctatcagcttcttttaaaaggacagcagccggaaaaagctgtttctcctgccatttat
catgattttgcggcatgggagaaaaacatgcttgccggcaaagacggtgtgaagcaccgt
acatattggcagaaacagctatcgggaactttgccgaatcttcagctgcctaatgtcagc
gcaagttcagtcgattctcagtttagagaggatacatacaccaggcggttgtccagcggc
ttcatgaatcaggtcagaacgtttgcgaaagagcattctgtaaatgtcacgacggtattc
ttaagctgctatatgatgctgcttggccgttacacaggccaaaaagaacagatcgtcggc
atgccggccatggtgaggccggaagaaagatttgatgatgccattggacattttctcaat
atgctcccgattcggagtgagctgaacccggcagacactttttctagctttatatcaaaa
ttgcaattaacgatattggatgggcttgatcatgcagcatatccttttccaaaaatggtg
agggatctgaatattcctcgcagtcaagcaggttcaccggtatttcaaaccgcttttttc
tatcagaattttcttcaatccggaagctatcaaagcttgctgagccgctatgctgacttc
ttttctgtcgatttcgttgagtatattcaccaagagggcgaatacgaattagtatttgaa
ctgtgggaaacagaagaaaaaatggagctgaacatcaagtacaatactgggctgtttgat
gcggcttctatatccgccatgttcgaccattttgtttatgtaacagagcaggcgatgttg
aatccttctcagcctttaaaagagtattctttattacctgaggcagagaagcagatgatt
ctcaaaacatggaacgccacaggaaaaacgtatccatatataacttttcatgagttgttt
gagcagcaggcgaaaaagacgcctgatagagcggctgtcagctatgaaggtcaaacattg
acgtatcgggagcttgatgagaaaagcacacagctggccatttatttgcaggcgcatgga
gtgggtcctgaccgtctggcggggatctatgtggatcgatcgctggacatgctagtgggt
ttattagcgatcctcaaggctgggggagcgtatgtgccgctagacccgtcctatccggct
gaacgattagaatacatgcttgaggacagtgaagttttcattacactgacgacatcggaa
ttagtaaatacgttgagttggaacggtgtcacaacagcccttttagatcaagattgggat
gaaattgctcaaacagcctctgatcgaaaagtgcttacacgcactgtcacgccagagaac
ttggcatatgtcatttatacatccggcagcacaggaaagccaaaaggtgtcatgatacca
cataaagctttgacaaactttctcgtttcgatgggggaaacaccaggtcttacggcagag
gataaaatgcttgctgtcacaacctactgttttgatattgcagctctggaattatttttg
cctttaataaagggcgcacactgctatatttgtcaaacggagcatacaaaagacgttgaa
aaactgaaacgggacatccgcgcgatcaaaccgacagtgatgcaggcaacccccgctacg
tggaagatgctcttttattcaggctgggaaaatgaagagagcgtgaaaattttatgcggt
ggcgaagcattgcctgagacattaaaacgatatttcttagatacgggcagcgaagcctgg
aatatgttcgggccaaccgaaacaactatctggtcagcggttcagcgcattaacgttgaa
tgctctcatgccacgataggaaggccaatcgccaatacacaaatctatattacggattct
cagctcgcgccagtgccggcaggtgttccgggtgagctgtgcattgcaggagacggtgtg
gcgaagggctactacaaaaaggaagaattaacggattcgagattcattgacaaccctttt
gagcctgggtctaagctttatagaacgggagacatggcccgttggcttacgggagggcga
attgaatatataggccgcatcgataatcaagtaaaaatccgcggattccgtattgaactt
ggtgatattgaaagcaggcttagtgagcatcccggcattctggaatgcgttgtggtcgca
gatatggataacctagctgcctattatacagctaaacatgcaaatgcttctctcacagcg
agagagctgcgtcattttgtgaaaaacgctttgcctgcctatatggtgccttcttatttt
attcagcttgatcatatgccgttaactccgaacggaaagatagatagaaacagccttaag
aatatcgatttatcaggggagcagctaaagcaaaggcagacctctcctaagaacattcag
gatactgtttttaccatttggcaggaagtgctgaaaacgagtgacattgaatgggatgac
ggatttttcgatgtgggcggggattcgcttctcgcggtcactgtggctgatcgtatcaaa
catgaactatcctgtgagttttctgtcacagacctgtttgagtattcaacgattaaaaat
atcagccagtacatcactgaacagcgaatgggcgatgcaagtgaccatataccgacagac
ccggcagctcatatagaagatcagtctaccgagatgagtgatctcccggactattatgac
gatagtgtggcgattattggcatatcgtgtgaatttccaggggcaaaaaatcatgatgaa
ttttgggagaacctcagagacggcaaggaaagcattgcgtttttcaataaagaagagctt
cagcgctttggcatttcaaaggagatagcggagaatgccgactatgtccctgctaaagct
tcaattgatgggaaagacagatttgatccaagcttctttcaaatctctcctaaagacgct
gaatttatggaccctcagcttcggatgctgctgactcattcatggaaagcaatagaagat
gccggttatgctgcgaggcagattccgcaaaccagtgtttttatgtcggcaagcaataat
tcttatcgcgcgctgctgccgtcagatacaacagagagcctggagacgccggacggctat
gtttcgtgggtgcttgcacagagcgggacgattccgacaatgatttctcataagctcggg
ctgagagggccaagctattttgtccatgccaactgctcatcctctctgattggattgcat
tctgcctataagagcctcctgtcgggtgaatctgattatgctttagttggcggtgcaacg
ctgcataccgagtcaaatatcggatatgtgcatcagcctgggctgaacttttcgagtgat
ggacatattaaagcttttgacgcttcagctgacggaatgataggcggtgagggcgttgct
gttgtattgctgaaaaaagcagctgatgcagtaaaggacggggatcatatctatgccttg
ctgagaggcattggtgtaaataacgacggcgctgacaaagtcggcttttatgctccaagc
gttaaaggccaggctgacgtggtccaacaggtcatgaatcaaacgaaggtacagcctgaa
tccatctgctatgtagaagcacacgggaccggaacgaagctgggggacccgatcgagctg
gcggctttaacaaacgtttacaggcaatatacaaataaaacgcaattttgcggcattggg
tcggtgaaaaccaatatcggacatttagatacagccgccggtcttgcgggctgcattaag
gttgtgatgagtctttatcatcaagagcttgcaccgagtgtcaattataaggagccgaat
ccaaatacagacttagccagctctcctttttacgtcgtcgatcaaaagaaaacgttaagc
cgtgagatcaaaacgcacagggctgcacttagctcgttcgggcttggcgggacaaatacc
catgccatttttgaacaattcaaaagggattcagataagggaaagatagacggaacctgc
atcgtcccgatctcggcgaaaaataaagagaggctgcaagagtatgcagaagacattctg
gcctatttagaaagaagagggtttgagaacagccagctgcctgattttgcgtataccctt
caggtggggcgcgaagcgatggagcatcgcgttgtctttattgccgatcatgtaaatgag
ttaaaacagaggctcacagattttatcaatggaaatacagcgattgaaggctgttttcaa
ggaagtaagcacaatgccagagaggtttcatggctgacggaggatgaggacagcgctgaa
ctcatacgtaagtggatggccaaaggaaaagtaaacaagcttgcagaaatgtggagcaag
ggagcgcatatagattggatgcagctttacaagggagagcgcccaaacagaatgagtctg
ccgacttatccatttgcaaaggaacgatactggccgtcgcaggatgaccgcaaaccggtg
gcgcagatatccggaaatcagacagggatcggctctattcatccattgcttcatcagaat
acatctgatttttctgaacagaaattcagttcggttttcactggtgacgaatttttcctg
agagaccatgtggtaagaggaaagcctgtgcttcctggtgttgcgtaccttgaaatggcg
tacgcggctataaaccaggcggcaggaagtgaaattggccaagatgtcagaatcagattg
aatcatacagtctgggttcagcctgttgtggttgacagacattcagctcaagtggatatc
agtctctttcctgaagaagatggaaaaatcacctttgacatttacagtacacaggaagac
ggggacgaccctgttattcatagtcaaggcagtgcggagctggcatctgccgccgaaacg
ccagtcgcagatctcactgaaatgtcacgccgttgcggcaaaggaaagatgtcgcctgat
caattttacgaagaaggcagaagcagaggaatgttccatggtccggcctttcaaggaatt
aagaatgtgaatataggaaacagagaggttttggcgcagctgcagcttccagaaatcgtt
tctggaacgaatgaacagtttgtgctgcacccaagtatcatggattccgccttgcagaca
gcaacaatatgcatcatgcaggaattgacggatcaaaagctgattttgccatttgcgctt
gaggagcttgaagtgatcaaagggtgttcttcttctatgtgggcttatgcccgcttaagt
gacagcgatcactccggaggggttgttcagaaagcggatatcgatgtcattgacgagagt
ggaaccgtatgtgtcaggatcaaaggattttcaacgagagtattagaaggggaggttcat
acttcaaagccttcaacacggcacgaacgcttaatgcttgaaccggtgtgggaaaaacag
aatgaagaacgagaggacgaagatctttcgtacacggagcatatcattgttctcttcgaa
actgaacgaagtgtcacagacagcattgcctcccacatgaaagatgcccgtgtgattact
ctaaacgaagctgtaggacatattgctgaacgttatcaatgttacatgcagaacattttt
gaactcctgcaaagcaaggtccgtaagctttctgcaggccgtatcatcattcaagcgatt
gttccgctggaaaaagagaagcaattgtttgccggcgtttccggtctgtttaaaacagca
gaaatagagttcagcaaactgactgctcaggtcatcgaaattgagaaacctgaagagatg
atagaccttcacctcaagctgaaagacgacagccggagaccatttgacaaacagattcga
tatgaggctggataccgttttgtgaaaggctggagggaaatggtgcttccttcagctgat
acgcttcacatgccgtggagagacgagggtgtttatctaatcacaggcggagcaggaagc
ttaggccttctgtttgcaaaggaaattgccaatcgaactggccggtctactattgtgctg
acgggacgatctgttttaagtgaggataaggaaaacgagctggaggctcttcgaagcatc
ggagcggaggttgtctatcgagaggctgatgtaagtgatcagcatgcggttcgtcatctt
ttggaggaaatcaaagaaagatatggcactctcaatggaattattcacggtgcaggcagc
agtaaagatcgcttcatcattcataaaacgaatgaagagtttcaagaagtgttgcagcca
aaagtgagcgggttgttacatgtagacgaatgcagcaaggatttcccattggactttttc
attttcttctcttctgtttcgggatgtttaggaaacgctggacaagccgattatgcggca
gccaattcgtttatggatgcatttgctgaataccgccgttctcttgcggcatcaaaaaag
agattcggctccaccatttccttcaattggccgttatgggaagaaggcggtatgcaagtc
ggcgctgaagatgaaaagagaatgctgaaaacgacgggaatggtcccgatgccgacagat
agtggcttgaaagcattttatcaagggatagtatctgataagccgcaagtttttgtgatg
gaaggacagcttcagaaaatgaagcaaaaactgctttccgcaggatcgaaagccaagcgg
aacgatcagagaaaggcggatcaggatcaaggacaaactagaaaattggaagcagcctta
atccaaatggttggcgcaattttgaaagtaaacactgacgatatcgatgtcaacacagag
ctgagtgagtacggattcgactcagttacattcactgtctttacaaacaagatcaacgaa
aaatttcaattggagctaacaccgaccatattctttgaatatggcagcgtccaaagcctg
gctgaatatgtagttgctgcgtatcagggcgaatggaatcaagatgctactgctaaaggc
aaagatgaaagaacaaacttagtgcacagtttaagcagcctggaggcatcattaagcaac
atggtcagtgcaattttaaaagtaaatagtgaagatattgatgtcaatacagagctgagt
gaatacggatttgattcagttacatttacggtctttacaaacaagatcaacgaagaattt
cagttggagctaacgccgaccattttctttgaatatggaagcctccacagcctggctgag
tatttgaccgttgaacatggtgacaccctggttcaggagcgagaaaaaccagaggggcag
gaagagttacagacaaaatcttctgaagcgccgaaaatcacatcacgtagaaagcgccgc
tttacacagcctattattgcaaaagcagaaagaaacaaaaagcaggctgccgattttgag
ccggttgcaattgtcggcatcagcggccggttccctggcgctatggatatagacgaattt
tggaaaaacctagaagaaggaaaagacagcatcacagaagttccaaaagatcgatgggat
tggcgggagcattatggaaacccagacactgacgtcaataaaaccgacatcaaatggggt
gggtttattgatggtgtcgcagagtttgatccgttgttttttggtatttcgccgcgagaa
gctgattatgtagaccctcagcagcgcttgttaatgacatacgtgtggaaggcattggaa
gatgcgggttgctcgccgcaaagcctttcgggtacagggaccggtatctttatcggtacg
ggaaacaccggttataaagatctattccatagagcgaatcttccaattgaaggccatgct
gctacaggtcatatgattccttcggtaggcccgaatagaatgagttattttttaaatatt
catggtccgagcgagccagtagagacggcttgttccagttctcttgtagccattcaccgt
gctgtgactgcgatgcaaaacggtgattgtgagatggcgatcgctggaggcgtgaatacg
atcttaaccgaggaggcgcatattagctacagcaaggcggggatgctcagcacagacggc
aggtgtaaaaccttctccgccgatgcgaatggctatgtcagaggcgaaggggtcggaatg
gtcatgttgaaaaagctggaagatgccgagcgcgacggaaatcatatttacggcgttatt
cggggcacggcggaaaatcacggcggaagagccaataccctgacatcgcctaatccgaaa
gcacaagctgatttgttggtgcgtgcatatcgccaagcagacatagatccaagcactgtc
acatatatcgaagcacatggaacagggacggaattgggcgatccgattgaaataaatggg
ctgaaagccgcgtttaaggaactatccaatatgagaggcgagagccagccggatgttccg
gatcaccgttgcggcatcggctcagttaaaagcaatatcggtcatttagagctagcagcc
ggtatttccggtttgatcaaggtgcttttgcaaatgaagcataaaacgttagtgaaaagc
ctgcattgcgagacgcttaatccttatcttcagctgactgacagtccgttttacatcgtt
caggaaaaacaggaatggaagtctgtcacagatcgtgacggaaacgagcttccgcgccgt
gccggaatcagttcgtttgggattggcggagtaaacgcgcatattgtgattgaagaatat
atgccaaaagccaattcagaacacacggctacagaacagccaaacgtaattgtgctgtcg
gctaaaaataaaagcaggctgatagatcgtgcttcgcaattgcttgaggtgattcgcaat
aaaaaatatactgatcaggatttgcaccgcatcgcttacaccctgcaggtcgggcgcgaa
gaaatggatgagcgtctggcgtgtgttgcggggacaatgcaggagcttgaagagaaactg
caggcgtttgttgacggtaaggaagaaacagacgaatttttccggggacagtctcatcga
aataaagagacccagactatttttacagcagatgaagatatggcgttggcacttgatgct
tggatcagaaaaagaaaatacgccaaacttgctgatttatgggtcaaaggggtctcaatc
cagtggaacacattatacggagagaccaaaccgcgcctgatcagcctcccttcatatccg
tttgcgaaggatcactattgggtgccggcaaaggaacattcagaaagagacaaaaaagaa
ctggttaatgcgattgaagatcgcgccgcatgctttttgacgaaacaatggagtttgagt
ccaattggatcagcagtgccggggacaagaactgttgccatcctgtgctgtcaagagaca
gcagatttagcagcagaagtgtcttcgtattttccgaatcatctcttaatagatgtgagc
cggatagaaaatgatcagtcagacattgattggaaagagtttgacggcctagtggatgtc
atcggatgcggttgggatgatgagggccggctggattggattgaatgggtgcaaagactg
gttgaattcgggcataaagaggggctcaggctgctttgtgtgacgaaggggctcgaatcg
tttcaaaacacatctgtccggatggctggcgcctcacgggctgggttgtatcgaatgctc
caatgcgagtacagccatcttatatcaaggcatatggatgctgaggaggttactgatcat
cgccgtctcgcgaagttgatcgctgatgagttttattccgattcttatgatgcggaggtt
tgctacagggatggtttacggtatcaagcttttctaaaagctcatccggaaacaggtaag
gccacggaacagagcgcggtcttcccgaaagatcatgtacttctcattacaggcggcaca
cgaggcatcggactattatgcgcccgtcattttgcagagtgctatggagtgaaaaaactg
gtgctgaccggacgagaacagcttcctccgcgagaggagtgggctcgttttaagacatca
aacacatcattggcagagaaaatccaggcagtgcgggagctggaagcgaagggtgtacag
gtggagatgctgtcgctgacgttatctgatgatgctcaggttgagcaaacgctgcaacat
atcaagcgaacattaggaccgattggcggtgtcattcattgtgcaggtctgacggatatg
gatacgctggcatttatccgaaaaacttcggatgatatccagcgggtgctggaacctaag
gtgtcaggtcttacaacgttatatcgccatgtgtgtaacgagcctttacagttttttgtc
ttattttcttctgtttcagccattattccggagctttcggcgggacaagctgactatgcg
atggccaatagctatatggattattttgcagaagcacatcagaaacatgcgccgatcatc
agtgttcagtggccgaactggaaagaaaccggtatgggtgaagtgacaaatcaagcgtat
cgggacagcggcttgttgagcattacgaattcagaaggcttacgttttctagatcaaatt
gtatcgaaaaagttcggaccggttgttctccctgcaatggcgaatcaaacaaactgggag
ccggaactgctgatgaagaggaggaaaccgcatgagggcggtttgcaggaagctgcttta
cagagcccgccagccagagacattgaagaggccgatgaagtttccaaatgtgatggatta
ttatctgaaacacagtcctggcttattgatctgtttaccgaagagctgagaatagatcgt
gaagacttcgagattgacgggttgtttcaggattatggcgtggattcgatcattttggca
caggtgctccagcgtataaaccgcaaattagaggcagcgctcgatccatcgattctatat
gaatacccgacaattcaaaggttcgcagattggctgatcggttcttattccgaaaggctg
tccgctttattcggaggcaggatatcggatgcatcagcacctttggagaacaaaatagag
gcggaggcatctgttcctgggaaggatcgagctcttacacctcagattcaggcgccagcg
attttgtcaccggactctcatgcagaaggtattgccgttgtcggactctcttgccgattc
cctggggcagagacattggagtcatattggtcgttactatccgaggggcgttcgtcaatc
ggcccgattccggcagagcgttggggctgtaagacgccatattatgccggcgtgattgat
ggcgtcagctattttgatcctgatttctttttgcttcacgaagaagacgtaagggcgatg
gatccgcaagcactgctcgtgttggaagagtgtctgaagctcttgtatcacgccggttat
acacctgaggaaataaagggcaagcccgtcggtgtttatatcggaggcagaagccagcac
aaacctgatgaagacagccttgatcatgccaagaatccgatcgtgacagtcggccaaaat
tatttagccgctaatctttcacaattttttgatgtccgcggtccaagtgttgtagttgac
actgcatgctcgtcagctttggtcggcatgaatatggccattcaggcgctgcgtggcgga
gatattcaatccgccatagtcggcggtgtcagcttgctgagctcagatgcgtctcacagg
ctgtttgaccggcgcggcattttaagcaagcattcatccttccatgtgtttgatgagcgt
gctgacggagttgtgttaggtgaaggcgtcggaatggtcatgctaaaaaccgtaaaacag
gcactggaagacggagatatcatatatgctgtcgtcaaagcggcctcggtcaataacgac
ggaagaacggcgggacctgcaacacctaatcttgaggcacaaaaggaagtcatgaaagat
gcgcttttcaaaagcggaaaaaaaccagaggacatcagctaccttgaggcaaacgggtca
ggttcaatcgtaaccgatctccttgagctaaaagcgatccaatcagtgtaccgttctggg
cactcatcgcctctttctcttggctcaatcaagccgaacatcgggcatccgctatgtgct
gaagggatcgccagcttcattaaggttgtgctgatgctgaaagagcgccgctttgtccca
tttttatcaggtgaaaaagagatggcgcatttcgatcaacagaaagcgaacatcacgttc
agccgagccctggaaaaatggacagattcgcagcctactgcggctattaactgctttgcc
gatggggggacgaatgcccatgtcatcgtagaggcgtgggaaaaagatgaaaaacacgcc
atcaagcgcagtccaatatcgcctcctcaattaaagaaacgaatgctttcgccaggcgag
ccaaagctggaagcggagacttcaaaaatgactgcggcaaacatatgggatacttatgag
gtggaggtctaa

DBGET integrated database retrieval system