KEGG   Bacillus subtilis subsp. subtilis 168: BSU17600Help
Entry
BSU17600          CDS       T00010                                 

Gene name
xylA
Definition
(RefSeq) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU17600 (xylA)
   00051 Fructose and mannose metabolism
    BSU17600 (xylA)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BSU17600 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Glyco_hydro_125 Ribosom_S30AE_C
Motif
Other DBs
NCBI-GeneID: 939558
NCBI-ProteinID: NP_389642
Pasteur: BG10806
BSORF: BG10806
UniProt: P0CI80
LinkDB All DBs
Position
1891908..1893245
Genome map
AA seq 445 aa AA seqDB search
MAQSHSSSINYFGSANKVVYEGKDSTNPLAFKYYNPQEVIGGKTLKEHLRFSIAYWHTFT
ADGTDVFGAATMQRPWDHYKGMDLAKMRVEAAFEMFEKLDAPFFAFHDRDIAPEGSTLKE
TNQNLDMIMGMIKDYMRNSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFMHMAVDYAKEIGYTGQFLIEPK
PKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGHPLLGWDTDEFPTDLYSTTLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLIY
AHIAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFTEGIGLEIIEGRANFHTLEQYALN
HKSIKNESGRQEKLKAILNQYILEV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatctcattccagttcaatcaactattttggaagcgcaaacaaagtggtttac
gaagggaaagattcgactaatcctttagcatttaaatattataatcctcaagaagtaatc
ggcggaaaaacgctgaaagagcatttgcgattttctattgcctattggcatacatttact
gctgatggtacagacgtttttggagcagctacgatgcaaagaccatgggatcactataaa
ggcatggatctagcgaagatgagagtagaagcagcatttgagatgtttgaaaaactagat
gcaccattctttgcttttcatgaccgggatattgcaccagaaggcagtacgctaaaagag
acaaaccaaaatttagatatgatcatgggcatgattaaagattacatgagaaatagcggc
gttaagctattatggaatacagcaaacatgtttacgaatccccgtttcgtccatggtgcc
gcgacttcttgcaatgcagatgtgtttgcgtatgctgcagcacaagtgaaaaaagggtta
gaaacagcaaaagagcttggcgctgagaactatgtattttggggcggccgtgaaggatat
gaaacattgttaaataccgatttaaaatttgagcttgataatttggctagatttatgcat
atggcagtggattatgcgaaggaaatcgggtacacagggcagtttttgattgagccaaaa
ccaaaagagccgaccacccatcaatacgatacagatgcagcaacaaccattgcctttttg
aagcaatatggcttagacaatcattttaaattaaatcttgaagccaatcatgccacatta
gccgggcatacattcgaacatgaattacgcatggcaagagtacatggtctgcttggctct
gttgacgcaaaccagggtcatcctcttttaggctgggacacggatgaatttccgacggat
ttatattctacgacattagcaatgtacgaaatcctgcaaaatggcggccttggaagcggc
ggattaaactttgacgcgaaggtcagaagatcttctttcgagcctgatgatctaatatat
gcccatattgcagggatggatgcatttgcaagaggattgaaagttgcccacaaattaatc
gaagatcgtgtgtttgaagatgtgattcaacatcgttaccgcagctttactgaagggatt
ggtcttgaaattatagaaggaagagctaatttccacacacttgagcaatatgcgctaaat
cataaatcaattaaaaacgaatctggaagacaggagaaattaaaagcgatattgaaccaa
tacattttagaagtataa

DBGET integrated database retrieval system