KEGG   Bacillus subtilis subsp. subtilis 168: BSU17620
Entry
BSU17620          CDS       T00010                                 

Symbol
yncB
Name
(RefSeq) endonuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: SNase DUF6567 DUF6520
Other DBs
NCBI-GeneID: 939569
NCBI-ProteinID: NP_389644
Pasteur: BG12265
BSORF: BG12265
UniProt: P94492 A0A6M3ZBG9
LinkDB
Position
complement(1895378..1896013)
AA seq 211 aa
MKKILISMIAIVLSITLAACGSNHAAKNHSDSNGTEQVSQDTHSNEYNQTEQKAGTPHSK
NQKKLVNVTLDRAIDGDTIKVIYNGKKDTVRYLLVDTPETKKPNSCVQPYGEDASKRNKE
LVNSGKLQLEFDKGDRRDKYGRLLAYVYVDGKSVQETLLKEGLARVAYVYEPNTKYIDQF
RLDEQEAKSDKLSIWSKSGYVTNRGFNGCVK
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaagaagattttgatcagtatgatcgcaatcgttttaagtattactttggcagcttgc
ggatcaaatcacgcagccaaaaaccattcagattctaatgggacggagcaagtctctcaa
gatactcactctaatgaatataatcagacagaacaaaaggctggcacgcctcattcaaaa
aatcagaagaaattggtcaatgttacattagatagagcaatagatggagatacgattaag
gttatttacaacggaaagaaagacacagttcgctacttgctcgttgatacacctgagacg
aagaaaccaaattcttgtgttcaaccatacggtgaggatgcgtcgaaacgaaataaagaa
ttggtcaacagcggtaagctacagctggaatttgataaaggcgatcgcagagataagtat
ggaagactgttagcatacgtttatgttgacggcaaatctgttcaagagacattattgaaa
gagggattggccagagtagcatatgtatatgagcctaacacaaaatacatagaccaattc
agactagatgagcaagaagcaaaatcagataaactgtcaatttggagtaagagcggttat
gtgacgaacagaggatttaatggctgtgtgaaatag

DBGET integrated database retrieval system