KEGG   Bacillus subtilis subsp. subtilis 168: BSU17680Help
Entry
BSU17680          CDS       T00010                                 

Gene name
thyA
Definition
(RefSeq) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00240  Pyrimidine metabolism
bsu00670  One carbon pool by folate
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BSU17680 (thyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU17680 (thyA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     BSU17680 (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-GeneID: 939555
NCBI-ProteinID: NP_389651
Pasteur: BG11190
BSORF: BG11190
UniProt: P0CI79
LinkDB All DBs
Structure
PDB: 

Position
1902219..1903058
Genome map
AA seq 279 aa AA seqDB search
MTQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVISKQMRFDNSEVPILTT
KKVAWKTAIKELLWIWQLKSNDVNDLNMMGVHIWDQWKQEDGTIGHAYGFQLGKKNRSLN
GEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKHGKLHLEVRA
RSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQF
EAPELWINPEVKDFYDFTIDDFKLINYKHGDKLLFEVAV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaattcgataaacaatacaattcaattataaaggatattatcaataatggaatc
tcagacgaagagtttgatgtaagaaccaagtgggactcagatggaacaccggcacatact
ctaagtgtaatcagtaagcaaatgagattcgacaactcagaggttccgattttaacgaca
aaaaaggttgcctggaaaacagccattaaagagttgctctggatttggcagctgaaatct
aatgatgttaatgatttaaacatgatgggcgtccatatttgggatcagtggaaacaagaa
gacggaaccatcggacatgcatatggatttcagctggggaagaaaaacagaagtctaaat
ggagaaaaagtggatcaggtagactatcttcttcatcaattgaagaacaatccatcttca
cgcagacacattacaatgctgtggaatcctgatgaattagacgcaatggccttaacgcca
tgtgtatacgagacacaatggtacgttaaacatgggaaactccaccttgaggtaagagca
cggagcaatgatatggcattgggaaatccattcaatgtattccagtataatgtgttgcag
cgcatgattgctcaagtgactggttatgagcttggtgaatatatctttaacattggggat
tgccatgtgtacacacgtcatatagacaatttgaaaattcaaatggaaagagaacagttt
gaagcacctgaactatggatcaatcctgaagtgaaagatttttatgactttaccattgat
gatttcaagttaatcaactataaacatggggacaagcttttatttgaggtagcggtttaa

DBGET integrated database retrieval system