KEGG   Bacillus subtilis subsp. subtilis 168: BSU17699
Entry
BSU17699          CDS       T00010                                 

Gene name
ynzK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YoqO GPI2
Other DBs
NCBI-GeneID: 8303021
NCBI-ProteinID: YP_003097731
UniProt: C0H417
LinkDB
Position
complement(1904393..1904749)
AA seq 118 aa
MYRNIVFYLILLCLFISVVMKSFEVIRTIANVICFIFVLLYFKDEMKTYSRKALAILSIC
FLFLVGICAFIILQGQTLMKRHLFFTGLETIAGILLIIVSLSICTFILRKISNRLKRM
NT seq 357 nt   +upstreamnt  +downstreamnt
ttgtatagaaacatcgtattttatctcattttactttgtctatttatatcagttgtcatg
aaaagctttgaggtgattagaacaatagccaatgttatctgctttattttcgtattgctg
tattttaaagatgaaatgaaaacatactcacgtaaagcgttagcaatcctaagtatttgt
tttcttttcttagtcggtatctgtgcttttatcattttacaaggacagacattgatgaaa
cgtcacctcttttttacaggcttggaaacgatagcgggcattcttttaataatcgtttct
ttaagcatttgtacttttattttgaggaaaatttcaaatcggttaaaacgaatgtga

DBGET integrated database retrieval system