KEGG   Bacillus subtilis subsp. subtilis 168: BSU18120
Entry
BSU18120          CDS       T00010                                 
Symbol
alsT
Name
(RefSeq) amino acid carrier protein AlsT
  KO
K03310  alanine or glycine:cation symporter, AGCS family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU18120 (alsT)
SSDB
Motif
Pfam: Na_Ala_symp DUF3974
Other DBs
NCBI-GeneID: 938191
NCBI-ProteinID: NP_389694
Pasteur: BG11798
BSORF: BG11798
UniProt: Q45068 A0A6M3ZBL9
LinkDB
Position
1938925..1940322
AA seq 465 aa
MESFFNSLINIPSDFIWKYLFYILIGLGLFFTIRFGFIQFRYFIEMFRIVGEKPEGNKGV
SSMQAFFISAASRVGTGNLTGVALAIATGGPGAVFWMWVVAAVGMASSFVESTLAQLYKV
RDGEDFRGGPAYYIQKGLGARWLGIVFAILITVSFGLIFNAVQTNTIAGALDGAFHVNKI
VVAIVLAVLTAFIIFGGLKRVVAVSQLIVPVMAGIYILIALFVVITNITAFPGVIATIVK
NALGFEQVVGGGIGGIIVIGAQRGLFSNEAGMGSAPNAAATAHVSHPAKQGFIQTLGVFF
DTFIICTSTAFIILLYSVTPKGDGIQVTQAALNHHIGGWAPTFIAVAMFLFAFSSVVGNY
YYGETNIEFIKTSKTWLNIYRIAVIAMVVYGSLSGFQIVWDMADLFMGIMALINLIVIAL
LSNVAYKVYKDYAKQRKQGLDPVFKAKNIPGLKNAETWEDEKQEA
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggagtcttttttcaatagtttgattaatattccaagtgatttcatctggaaataccta
ttttatattttaatagggcttggattattttttaccatacgttttggttttatccaattc
cgttattttattgaaatgttcagaatagtaggggagaagccggaaggaaataaaggtgtt
tcatctatgcaggcattctttatttcggccgcatcccgagtcggcacagggaatttgact
ggtgtagccttagcaattgcgacaggcggaccaggcgctgtattttggatgtgggtagtg
gctgcagtaggcatggcttcaagctttgtcgaaagtacattagcacagctttataaggta
agagacggggaggatttccgcggagggccggcctactatattcaaaagggtcttggtgcc
agatggcttggcatcgtttttgcaatcttaattaccgtctcattcggcttgatttttaac
gctgttcaaacaaatacaattgctggagcattggatggcgcattccatgtaaataaaata
gttgtagccatagttctggcggttttaactgcgtttatcattttcggcggtttaaaacgt
gttgtcgctgtttcacagctaattgtgccggttatggcaggcatttatattcttatcgct
ttatttgttgtcatcacgaatattacggctttccctggcgttatcgctacaattgttaaa
aatgctttaggttttgaacaagtcgtcggcggcggaataggcggcatcatcgttatcggt
gcgcaacgcggacttttttcaaacgaagcaggaatggggagcgcaccaaacgcggctgcg
acggctcatgtatcccatccggcaaagcaaggctttattcaaacattaggcgtatttttc
gatacatttatcatatgtacgtccacagcatttattattttgctgtacagtgtaacgcca
aaaggcgacggcatccaagtcacacaggctgctcttaaccatcacattggaggctgggcg
ccgactttcatcgcagtcgcaatgttcttgtttgcattcagttcagttgtcggcaactat
tattatggcgagacaaacattgaatttattaaaacaagcaaaacatggctgaacatttac
cgtatcgctgttattgctatggttgtgtatggatctttatcaggcttccaaatcgtttgg
gatatggcggacctctttatgggtatcatggcgctgatcaacttaattgtgattgcgctg
ctgtcaaacgttgcttacaaagtgtataaagattacgcgaaacagcgtaagcaaggactt
gatcctgtgtttaaagcgaaaaacatcccagggctgaaaaacgctgaaacatgggaagat
gagaaacaagaagcataa

DBGET integrated database retrieval system