KEGG   Bacillus subtilis subsp. subtilis 168: BSU18500
Entry
BSU18500          CDS       T00010                                 
Symbol
fabG
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase GDP_Man_Dehyd Asp_Glu_race DUF1776 DUF2452 Shikimate_DH
Other DBs
NCBI-GeneID: 940090
NCBI-ProteinID: NP_389732
Pasteur: BG11048
BSORF: BG11048
UniProt: P14802 A0A6M4JHA5
LinkDB
Position
complement(2018554..2019270)
AA seq 238 aa
MQSLQHKTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVKALGVKAAFA
AADVKDADQVNQAVAQVKEQLGDIDILINNAGISKFGGFLDLSADEWENIIQVNLMGVYH
VTRAVLPEMIERKAGDIINISSTAGQRGAAVTSAYSASKFAVLGLTESLMQEVRKHNIRV
SALTPSTVASDMSIELNLTDGNPEKVMQPEDLAEYMVAQLKLDPRIFIKTAGLWSTNP
NT seq 717 nt   +upstreamnt  +downstreamnt
ttgcaaagtttacaacataaaactgcactaatcacaggcggaggcagaggaattggccgc
gctactgctctggcgcttgccaaagaaggcgtgaatatcgggttaattggccggacttcc
gctaatgtagaaaaagtggctgaagaagtcaaagcgcttggtgtaaaagctgcatttgct
gctgcagatgtaaaagatgccgatcaggttaaccaagctgtagctcaagtgaaggaacag
ctcggtgatatcgatatcctcattaataatgccggcatcagcaaatttggcggtttctta
gatctgtcagctgatgagtgggaaaatattattcaagtcaacctaatgggtgtgtaccat
gtcactcgcgcggtgcttccggaaatgatcgaacgcaaagccggagacatcattaatatt
tcatctacagcgggccaaagaggagctgctgtaacaagtgcttacagcgcttctaaattt
gccgttctcgggttaacagagtctcttatgcaagaagtgagaaaacataatatcagagtc
agcgcgttaacgccgagcactgtcgctagtgatatgtctatcgaattgaacttaacagac
ggtaatcctgaaaaagttatgcagcctgaggatcttgctgagtacatggtggcacaactg
aaattagatcctcgtattttcatcaaaacagcgggattatggtcaacaaatccttaa

DBGET integrated database retrieval system