KEGG   Bacillus subtilis subsp. subtilis 168: BSU19579
Entry
BSU19579          CDS       T00010                                 

Symbol
yoyD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3311 DUF3533
Other DBs
NCBI-GeneID: 8303187
NCBI-ProteinID: YP_003097742
UniProt: C0H431 A0A6M3ZBZ7
LinkDB
Position
2130177..2130377
AA seq 66 aa
MVKKALIVILILLPFVQLALLPLVNRIEPIMFGLPFFHFWLLLWIIVTPLCSFGIYQMQK
KDGGLE
NT seq 201 nt   +upstreamnt  +downstreamnt
atggttaaaaaagcacttattgttattctcattcttttgccattcgttcagctcgcgctt
ttgccgcttgtgaatcgaatagaaccgattatgttcggcctgccgtttttccacttttgg
ctgctgctgtggattattgttacgccgttatgctcgtttggcatttatcagatgcaaaaa
aaagatggaggacttgaataa

DBGET integrated database retrieval system