KEGG   Bacillus subtilis subsp. subtilis 168: BSU21240
Entry
BSU21240          CDS       T00010                                 

Symbol
yomS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939152
NCBI-ProteinID: NP_390007
Pasteur: BG13606
BSORF: BG13606
UniProt: O31965 A0A6M4JN40
LinkDB
Position
2242056..2242412
AA seq 118 aa
MTETTENVVITIPDKTSFTFHEAATSPSEGEEFVVGHFRELTVKISGSSTSREIKFYAVD
ENGEKTALSGTNKTDFQLGSSTLNTNEYWDFDIAGLFKVMFEVVSVTGDVTVKGIVVS
NT seq 357 nt   +upstreamnt  +downstreamnt
ttgacagaaacgactgaaaatgtcgtaatcacgattccagacaaaacttcatttacattt
cacgaagccgcaacttccccatctgaaggtgaagaatttgtagtgggtcattttcgggaa
cttactgttaagatctctggttcctcaacttcacgagaaataaagttttatgcagttgat
gaaaatggcgaaaaaactgcacttagtggcaccaataaaacagacttccaacttgggagc
agtactttaaatactaatgagtattgggacttcgacattgctggattgtttaaagttatg
ttcgaagtagtttctgttactggtgatgtaactgttaaagggattgtggtgagttaa

DBGET integrated database retrieval system