KEGG   Bacillus subtilis subsp. subtilis 168: BSU21810
Entry
BSU21810          CDS       T00010                                 

Gene name
dfrA
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00670  One carbon pool by folate
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU21810 (dfrA)
   00670 One carbon pool by folate
    BSU21810 (dfrA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BSU21810 (dfrA)
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-GeneID: 939091
NCBI-ProteinID: NP_390064
Pasteur: BG10795
BSORF: BG10795
UniProt: P11045 A0A6M3ZGH1
LinkDB
Position
complement(2296603..2297109)
AA seq 168 aa
MISFIFAMDANRLIGKDNDLPWHLPNDLAYFKKITSGHSIIMGRKTFESIGRPLPNRKNI
VVTSAPDSEFQGCTVVSSLKDVLDICSGPEECFVIGGAQLYTDLFPYADRLYMTKIHHEF
EGDRHFPEFDESNWKLVSSEQGTKDEKNPYDYEFLMYEKKNSSKAGGF
NT seq 507 nt   +upstreamnt  +downstreamnt
atgatttcattcatttttgcgatggatgccaacaggcttatcggcaaagacaatgatttg
ccgtggcatttgcccaatgatcttgcatactttaagaaaataacatcgggccattcaatc
attatgggccggaaaacatttgaatcgatcggacgtccgcttccaaatcggaaaaatatt
gtcgttacctcagcgccggattcagaatttcagggatgcacggttgtcagttcattaaag
gatgtactggacatttgttcaggccctgaagaatgctttgtgatcggaggggctcagctc
tatacggacctgttcccttatgcggacagactgtatatgacgaaaattcatcacgagttt
gagggtgaccgtcactttcctgaatttgatgaatccaattggaagctggtttcttctgag
caggggaccaaagacgaaaaaaacccgtatgattacgaatttctaatgtatgaaaaaaag
aattcttctaaagcgggaggattttaa

DBGET integrated database retrieval system