KEGG   Bacillus subtilis subsp. subtilis 168: BSU23110
Entry
BSU23110          CDS       T00010                                 

Gene name
resE
Definition
(RefSeq) sensor histidine kinase
  KO
K07651  two-component system, OmpR family, sensor histidine kinase ResE [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU23110 (resE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU23110 (resE)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU23110 (resE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU23110 (resE)
Protein kinases [BR:bsu01001]
 Histidine kinases
  OmpR family
   BSU23110 (resE)
Two-component system [BR:bsu02022]
 OmpR family
  ResE-ResD (aerobic and anaerobic respiration)
   BSU23110 (resE)
SSDB
Motif
Pfam: HisK_sensor HATPase_c HisKA HAMP PAS HATPase_c_3 HATPase_c_5 HATPase_c_2 PAS_4 PAS_9 Peptidase_C1_2 ATP-synt_8
Other DBs
NCBI-GeneID: 938965
NCBI-ProteinID: NP_390192
Pasteur: BG10535
BSORF: BG10535
UniProt: P35164 A0A6M4JNC2
LinkDB
Structure
PDB: 
4ZR7

Position
complement(2415415..2417184)
AA seq 589 aa
MKFWKSVVGKLWFTILSLVLIVLFILTVLLLEFIENYHVEEAENDLTQLANKVAVILENH
EDQALARSITWELADNLTSIAIIQDEKNHWYSPNDKNRLSSITVEQIQHDKDLNKALKDH
KKVSKRTGLSDTDTDNERLIVGVPYEKDGKKGMVFLSQSLLAVKDTTKHTTRYIFLAAGI
AIVLTTFFAFFLSSRVTYPLRKMREGAQDLAKGKFDTKIPILTQDEIGELATAFNQMGRQ
LNFHINALNQEKEQLSNILSSMADGVITINIDGTILVTNPPAERFLQAWYYEQNMNIKEG
DNLPPEAKELFQNAVSTEKEQMIEMTLQGRSWVLLMSPLYAESHVRGAVAVLRDMTEERR
LDKLREDFIANVSHELRTPISMLQGYSEAIVDDIASSEEDRKEIAQIIYDESLRMGRLVN
DLLDLARMESGHTGLHYEKINVNEFLEKIIRKFSGVAKEKNIALDHDISLTEEEFMFDED
KMEQVFTNLIDNALRHTSAGGSVSISVHSVKDGLKIDIKDSGSGIPEEDLPFIFERFYKA
DKARTRGRAGTGLGLAIVKNIVEAHNGSITVHSRIDKGTTFSFYIPTKR
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaaattttggaaaagcgtagtaggcaagctgtggtttacgatcctttcactcgtcttg
atcgtattgttcattttaacggttcttttgctggagtttattgaaaactaccatgtggaa
gaagctgagaatgatttaacacagcttgcgaataaagttgctgtcatcctagaaaatcac
gaggaccaggcactggcaaggtcaatcacttgggaactcgctgataacttaacaagcatt
gccatcatccaggatgagaagaaccactggtattctccgaatgataaaaatcgcctgtcg
tctattacggttgagcaaatacagcatgacaaagacttaaataaagctctcaaagaccat
aaaaaagtaagcaaacggacgggactgagcgatacagacacggataatgaacgcctgatt
gtaggtgtcccgtatgaaaaagacggaaagaaaggcatggtctttttatcccagtctttg
cttgccgttaaagatacaacaaaacatacgacccgctatatttttcttgccgctggaatt
gcgattgtgctgaccacatttttcgcattctttttatcaagcagggtcacgtaccctctc
cgaaaaatgagagaaggcgcgcaggatttggcgaagggcaagttcgatacaaaaatcccg
attttaactcaggatgaaatcggtgaactggcgaccgcttttaatcaaatgggccggcag
cttaactttcatatcaatgcgctcaatcaagaaaaagagcagctttctaacattttgagc
agtatggctgacggggttattaccattaatattgacggtacgattcttgtgaccaacccg
ccggctgaacgttttcttcaggcttggtattatgaacagaacatgaatatcaaagaaggc
gacaatcttccgcctgaagcaaaagagctgtttcaaaacgctgtcagcactgaaaaagaa
caaatgattgagatgacgcttcaaggcagatcatgggtgcttttgatgtcgccgctttat
gcggaatcgcacgtcagaggagcggttgccgtactgcgtgacatgacagaagaacgccgc
cttgataagctgcgggaggactttatcgcaaatgtcagtcatgagctgagaacaccgatc
tccatgcttcagggatacagtgaagcaattgtcgatgacattgcaagctctgaagaagac
cggaaagaaattgcccaaatcatttatgacgaatcgctccgaatgggccgtttagttaat
gatttgcttgatttagcccgaatggaatcaggccatacaggcttacattatgaaaaaatc
aatgtgaatgagtttttagaaaagatcattcggaagttttccggtgttgcgaaagaaaaa
aatattgctttagatcatgacatttctctcacagaagaggaatttatgtttgatgaagac
aagatggagcaggtatttaccaatttgattgataacgcgctgcggcatacttcagccggc
ggcagtgtctccatttcagtccattctgtgaaggatggattgaaaattgatatcaaagac
tccgggtctggcataccggaagaagatctgccatttatctttgagcggttttataaggca
gataaagcgcggacaaggggcagagcaggaaccgggttagggctggctatcgttaaaaat
atcgtggaagcccacaacggatcaattactgtgcacagccgaatagataaaggaacaaca
ttttctttttatattccgacaaaacggtaa

DBGET integrated database retrieval system