KEGG   Bacillus subtilis subsp. subtilis 168: BSU23510
Entry
BSU23510          CDS       T00010                                 
Symbol
xerD
Name
(RefSeq) tyrosine recombinase XerD
  KO
K04763  integrase/recombinase XerD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU23510 (xerD)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BSU23510 (xerD)
SSDB
Motif
Pfam: Phage_integrase Phage_int_SAM_1 Phage_int_SAM_4 Phage_int_SAM_5 DUF3435 Integrase_1
Other DBs
NCBI-GeneID: 938726
NCBI-ProteinID: NP_390232
Pasteur: BG11332
UniProt: P46352 A0A6M4JNL9
LinkDB
Position
complement(2448591..2449481)
AA seq 296 aa
MKDQIKDFIHYVMVERGLSQNTIVSYERDLKSYSLYLTETLHVTDWNHVTRIHIIQYLKH
LKDSGKSGKTSARHLASIRSFHQFLLREKVTDKDPSVHIETQKTERALPKVLALNEVERL
LDTPKLTSPFGYRDKAMLELLYATGIRVSEMIELKTADVHLSMGFIRCFGKGRKERIVPI
GEAAASAIEEYMTKARGKLLKNNVSDALFLNHHGKQISRQGFWKNLKKIALEAGIKKELT
PHTLRHSFATHLLENGADLRAVQEMLGHADISTTQIYTHVTKTRLKDVYKQFHPRA
NT seq 891 nt   +upstreamnt  +downstreamnt
gtgaaagatcaaataaaggatttcatccactacgttatggtagagagagggctctctcaa
aatacgatcgtatcctatgaacgtgacttgaaaagctattctctctacttaacagaaacc
cttcatgttacagattggaatcacgttacccgcatacatattatccaatacttaaagcat
ttgaaggactcggggaaatccggcaagacatcggcgcggcatttggcatccattcgctct
tttcatcaatttctgctcagggaaaaagtaacggataaggacccttccgttcatatcgaa
acacaaaagacggaacgggcgcttccgaaggtgctcgcgctcaatgaagtcgagcggtta
ttggacacgcctaagctgacgagccctttcggatatcgggataaagcaatgctggagctg
ctttatgcgacaggcatacgagtcagtgaaatgattgaattgaaaacggctgatgttcat
ttatctatggggtttatccgatgcttcggcaaaggaagaaaagaacggattgtgccaatc
ggtgaagccgctgcttccgccattgaggaatatatgacaaaagccaggggaaaactgtta
aaaaataatgtatctgacgccctctttttaaatcatcacggcaaacagatcagccgccag
ggattttggaagaacctgaaaaaaatcgcattggaagccggcattaagaaagagctgact
ccgcatacactcaggcattcctttgcgacgcatctgcttgagaacggggcagatttaaga
gcggtgcaggaaatgctcggtcatgcggatatatccacgacgcaaatttatacgcatgtg
acgaaaacaaggctgaaggatgtgtacaagcagtttcatccgcgagcatag

DBGET integrated database retrieval system