KEGG   Bacillus subtilis subsp. subtilis 168: BSU23820
Entry
BSU23820          CDS       T00010                                 

Gene name
yqjM
Definition
(RefSeq) NADPH dehydrogenase
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU23820 (yqjM)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     BSU23820 (yqjM)
SSDB
Motif
Pfam: Oxidored_FMN Dus G3P_antiterm
Other DBs
NCBI-GeneID: 938698
NCBI-ProteinID: NP_390263
Pasteur: BG11742
BSORF: BG11742
UniProt: P54550 A0A6M3ZDT0
LinkDB
Structure
PDB: 
1Z41 1Z44 1Z48 1Z42

Position
2475843..2476859
AA seq 338 aa
MARKLFTPITIKDMTLKNRIVMSPMCMYSSHEKDGKLTPFHMAHYISRAIGQVGLIIVEA
SAVNPQGRITDQDLGIWSDEHIEGFAKLTEQVKEQGSKIGIQLAHAGRKAELEGDIFAPS
AIAFDEQSATPVEMSAEKVKETVQEFKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSN
HRTDEYGGSPENRYRFLREIIDEVKQVWDGPLFVRVSASDYTDKGLDIADHIGFAKWMKE
QGVDLIDCSSGALVHADINVFPGYQVSFAEKIREQADMATGAVGMITDGSMAEEILQNGR
ADLIFIGRELLRDPFFARTAAKQLNTEIPAPVQYERGW
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggccagaaaattatttacacctattacaattaaagatatgacgttaaaaaaccgcatt
gtcatgtcgccaatgtgcatgtattcttctcatgaaaaggacggaaaattaacaccgttc
cacatggcacattacatatcgcgcgcaatcggccaggtcggactgattattgtagaggcg
tcagcggttaaccctcaaggacgaatcactgaccaagacttaggcatttggagcgacgag
catattgaaggctttgcaaaactgactgagcaggtcaaagaacaaggttcaaaaatcggc
attcagcttgcccatgccggacgtaaagctgagcttgaaggagatatcttcgctccatcg
gcgattgcgtttgacgaacaatcagcaacacctgtagaaatgtcagcagaaaaagtaaaa
gaaacggtccaggagttcaagcaagcggctgcccgcgcaaaagaagccggctttgatgtg
attgaaattcatgcggcgcacggatatttaattcatgaatttttgtctccgctttccaac
catcgaacagatgaatatggcggctcacctgaaaaccgctatcgtttcttgagagagatc
attgatgaagtcaaacaagtatgggacggtcctttatttgtccgtgtatctgcttctgac
tacactgataaaggcttagacattgccgatcacatcggttttgcaaaatggatgaaggag
cagggtgttgacttaattgactgcagctcaggcgcccttgttcacgcagacattaacgta
ttccctggctatcaggtcagcttcgctgagaaaatccgtgaacaggcggacatggctact
ggtgccgtcggcatgattacagacggttcaatggctgaagaaattctgcaaaacggacgt
gccgacctcatctttatcggcagagagcttttgcgggatccattttttgcaagaactgct
gcgaaacagctcaatacagagattccggcccctgttcaatacgaaagaggctggtaa

DBGET integrated database retrieval system