KEGG   Bacillus subtilis subsp. subtilis 168: BSU24020
Entry
BSU24020          CDS       T00010                                 

Gene name
bmrR
Definition
(RefSeq) MerR family transcriptional regulator
  KO
K19575  MerR family transcriptional regulator, activator of bmr gene
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU24020 (bmrR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    BSU24020 (bmrR)
SSDB
Motif
Pfam: MerR_1 GyrI-like MerR Cass2 DUF705
Other DBs
NCBI-GeneID: 938676
NCBI-ProteinID: NP_390282
Pasteur: BG10304
BSORF: BG10304
UniProt: P39075 A0A6M4JIZ1
LinkDB
Structure
PDB: 

Position
2495898..2496734
AA seq 278 aa
MKESYYSIGEVSKLANVSIKALRYYDKIDLFKPAYVDPDTSYRYYTDSQLIHLDLIKSLK
YIGTPLEEMKKAQDLEMEELFAFYTEQERQIREKLDFLSALEQTISLVKKRMKRQMEYPA
LGEVFVLDEEEIRIIQTEAEGIGPENVLNASYSKLKKFIESADGFTNNSYGATFSFQPYT
SIDEMTYRHIFTPVLTNKQISSITPDMEITTIPKGRYACIAYNFSPEHYFLNLQKLIKYI
ADRQLTVVSDVYELIIPIHYSPKKQEEYRVEMKIRIAE
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaaggaatcgtattactcaattggggaagtatcaaaactggcaaacgtgtcgataaaa
gcgctccgttattacgataaaattgatttatttaaaccagcctacgtcgacccggatacc
agctaccgctattatacagattctcagctcattcatctggatttgatcaaatcattgaaa
tatatcggcacacctttagaagagatgaaaaaagcacaggacttagagatggaagaactg
tttgctttttatacagagcaggagaggcaaatcagggagaaattagactttttatcagcc
ctggagcaaaccatttcattggtgaaaaagcggatgaaacggcagatggaatatcccgcg
ctcggtgaggtgtttgttttagatgaagaagaaatacggatcattcagacagaggcagaa
ggaatcgggcctgaaaacgtgctcaacgcctcctacagcaaattaaaaaaatttatcgag
tcagcagatggatttacgaacaatagctacggcgctactttctcttttcagccctacacc
agcattgatgaaatgacttaccgtcatattttcacacctgtattgacgaataaacagatt
tcatcaattacgccggatatggaaatcacaacgatccctaaagggaggtatgcgtgtatc
gcgtataatttttcgcctgaacattattttctcaacttacagaagcttatcaaatatatc
gcggaccgccaattaacagttgtcagtgatgtatacgagttaatcataccgattcattac
tccccgaaaaaacaagaagaatatcgagtcgaaatgaaaatacggatcgctgaataa

DBGET integrated database retrieval system