KEGG   Bacillus subtilis subsp. subtilis 168: BSU24210
Entry
BSU24210          CDS       T00010                                 

Gene name
yqiG
Definition
(RefSeq) NADH-dependent flavin oxidoreductase YqiG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Oxidored_FMN DHO_dh DUF1877
Other DBs
NCBI-GeneID: 938659
NCBI-ProteinID: NP_390301
Pasteur: BG11716
BSORF: BG11716
UniProt: P54524 A0A6M4JNE6
LinkDB
Position
2516440..2517558
AA seq 372 aa
MNPKYKPLFEPFTFKSGVTINNRIAVAPMTHYASNEDGTISEAELDYIIPRSKEMGMVIT
ACANVTPDGKAFPGQPAIHDDSNIPGLKKLAQAIQAQGAKAVVQIHHGGIECPSELVPQQ
DVVGPSDVFDNGKQIARALTEEEVENIVKAFGEATRRAIEAGFDGVEIHGANGYLIQQFY
SPKTNQRTDRWGGSDEKRLAFPLAIVDEVKKAASEHAKGAFLVGYRLSPEEPETPGLTMT
ETYTLVDALGDKELDYLHISLMDVNSKARRGADPTRTRMDLLNERVGNKVPLIAVGSIHS
ADDALAVIENGIPLVAMGREILVDPNWTVKVKEGREKQIETVIKGTDKEKYHLPEPLWQA
IVNTQGWVPYKD
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaatcctaagtataagccactttttgaaccatttacgtttaaaagcggcgttacaatc
aacaaccggatcgcagtagcaccgatgactcattacgcttctaatgaagacggtacaata
tctgaagcggagctcgactacatcatcccccgttcaaaagagatgggaatggtgattaca
gcctgcgcaaatgttacaccggacggaaaagcattccccgggcagccggccatccatgac
gattccaacattccaggtttaaaaaagttagcacaagccattcaggcacaaggcgctaaa
gctgttgtacaaattcatcacggcggtattgagtgcccgtctgagctcgttcctcaacag
gatgttgtggggccaagtgacgtgtttgataacggcaaacaaattgctcgcgcattaaca
gaagaagaagtggaaaacattgtgaaggcgtttggagaagcgacaagacgcgccattgaa
gccggctttgacggtgtcgaaattcacggtgcaaacggctacttaattcagcagttttat
tctccgaaaaccaaccagcgcacggatcgctggggaggaagcgatgaaaaacgattagcc
ttcccgctcgctattgtcgatgaagtgaaaaaagccgcttcagaacatgcgaagggtgca
ttcttagtcggctaccgcctgtctccggaagaacctgagacaccgggattgacaatgact
gaaacttatacgcttgttgatgctttaggggataaagaattggattatcttcatatctca
ctgatggacgtgaactcaaaagcgcgccgcggtgcagatccgactcgcacacgcatggac
ttattgaatgaacgtgtcggaaacaaagtgccgctgatcgccgtcggttccatccattcc
gctgatgacgcgcttgccgtcatcgaaaacggtattccactggtcgctatgggacgcgaa
attctagttgaccctaactggacggtaaaagtaaaagaaggccgtgaaaagcaaatcgaa
acagtgatcaaaggcacagataaagaaaaatatcatttgcctgaaccgctatggcaagca
attgtgaacacacaaggctgggtgccttataaagattaa

DBGET integrated database retrieval system