KEGG   Bacillus subtilis subsp. subtilis 168: BSU24950
Entry
BSU24950          CDS       T00010                                 
Symbol
pstBB
Name
(RefSeq) phosphate import ATP-binding protein PstB 1
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU24950 (pstBB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU24950 (pstBB)
Enzymes [BR:bsu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     BSU24950 (pstBB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    BSU24950 (pstBB)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_23 RsgA_GTPase AAA_29 Rad17 AAA_10 AAA_30 AAA_22 G-alpha Septin AAA_11 NB-ARC AAA_16 Rad51 Adeno_IVa2 RNA_helicase AAA_24 ATPase_2 AAA AAA_28 PRK Mg_chelatase AAA_33 PhoH AAA_25 AAA_18 AAA_14
Other DBs
NCBI-GeneID: 938205
NCBI-ProteinID: NP_390374
Pasteur: BG11379
BSORF: BG11379
UniProt: P46342 A0A6M3ZEG9
LinkDB
Position
complement(2577210..2577992)
AA seq 260 aa
MSIATEAVMKQEVYQVNGMNLWYGQHHALKNINLSIYENEVTAIIGPSGCGKSTFIKTLN
LMIQMTPNVKLAGELNYNGSNILKDKVDIVDLRKNIGMVFQKGNPFPQSIFDNVAYGPRV
HGTKNKKKLQEIVEKSLKDVALWDEVKDRLHTSALSLSGGQQQRLCIARALATNPDILLM
DEPTSALDPISTRKIEELILELKDKYTIVIVTHNMQQAARVSDQTAFFYMGELVECDNTN
KMFSNPKDQRTLDYISGKFG
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagtattgctaccgaagctgtaatgaaacaggaagtatatcaagtcaatggaatgaac
ttatggtatgggcagcatcatgctttaaaaaatatcaatttgagcatttatgaaaatgag
gttacggcgattatcggaccatccggatgcgggaaatcgacctttatcaagacattgaat
ttaatgattcaaatgacgccgaatgtaaagcttgcaggtgagctgaactataatggcagc
aacattttaaaggataaagtggacatcgtggatttgcgaaaaaatatcggcatggtattc
caaaaagggaatccgtttccgcaatctatttttgataatgtggcttacggaccgagagtc
cacggcaccaaaaataagaagaagcttcaggaaattgtggaaaagtcattaaaagacgtg
gcgttatgggatgaggtgaaggatcgattgcatacgtccgctctttcgctgtcagggggc
cagcagcagcgtctttgcatcgccagagcacttgcgaccaatcctgatattttgctgatg
gatgaaccgacatctgcactagatccaatctcaacgagaaaaattgaagaactcattcta
gagctgaaagataaatatacaattgtcattgtcacgcataacatgcagcaggcagcaagg
gtttctgatcaaaccgcctttttctacatgggcgagcttgttgaatgcgacaatacgaat
aaaatgttctctaacccgaaggaccaaagaacgctcgattacatttcaggaaagtttgga
tga

DBGET integrated database retrieval system