KEGG   Bacillus subtilis subsp. subtilis 168: BSU25110
Entry
BSU25110          CDS       T00010                                 
Symbol
yqfU
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YitT_membrane DUF2179 Ribosomal_L14
Other DBs
NCBI-GeneID: 937944
NCBI-ProteinID: NP_390390
Pasteur: BG11667
BSORF: BG11667
UniProt: P54478 A0A6M3ZDZ1
LinkDB
Position
complement(2592003..2592884)
AA seq 293 aa
MTPTKQHKKETFTHFIFRVFMILVGAASAAVSIELFLIPNDFIDGGIIGVSLILDHLFMS
NPFLNFAFFVVILNIPFMIFGYKYIGKTFLVSTFIGIVGLAVIESSLHHVEAITTQPILA
TVFGGLLLGFGVGLVIRNGGSMDGTEILGILLTKKLPFSVGEFVMFINVFIFIWAVFVFG
PEQAMYSFMTYYIAMKTIDAVIQGLDETKAVIIVSEQYDEISDAILHRLGRGTTKLKGKG
GYTDEEKDVIYAVVTRLEVTKLKSIVFEVDQNAFITIMNTHETRGGKFKNAIH
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaccccaacaaaacaacataagaaagaaacatttacccattttattttcagggtcttt
atgattctggtaggagctgcatctgcggctgtaagtattgaattatttttaatccccaat
gattttattgatggcgggattatcggtgtatctcttattttagaccacctctttatgtca
aacccctttctgaatttcgcttttttcgttgtcatattaaatattccttttatgatcttc
ggatataaatatatcggtaagacctttctagtctctacgtttatagggattgtcgggctt
gccgttattgaatcctcacttcaccatgtagaagccattacaacccagcctattttggct
actgtgttcggaggtcttttactcggctttggcgtcgggcttgttattcgaaatggaggt
tcaatggatggtacagaaattctcggtattttgctgaccaaaaaactcccgttttctgta
ggtgagttcgttatgttcatcaatgtgttcattttcatttgggcagtttttgtgttcggt
cctgagcaagcgatgtactcattcatgacttattatattgcgatgaaaacgattgatgcc
gtgatccaagggcttgatgaaacaaaagctgtcattattgtgtctgagcagtatgatgag
atttccgacgcgattttgcaccgtctcggtcggggcacaacgaagctgaaggggaaaggc
gggtatacggacgaagaaaaagacgtaatttacgcggttgtcacaaggctggaagtgaca
aagctcaaatcgatcgtgtttgaagttgatcaaaatgcattcataacaattatgaatact
catgaaacgagaggcggaaaattcaaaaacgcaatccactag

DBGET integrated database retrieval system