KEGG   Bacillus subtilis subsp. subtilis 168: BSU25150
Entry
BSU25150          CDS       T00010                                 

Symbol
yqfQ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YqfQ CDC45 Mitofilin CobT CLN3 CPSF100_C DDHD
Other DBs
NCBI-GeneID: 937910
NCBI-ProteinID: NP_390394
Pasteur: BG11663
BSORF: BG11663
UniProt: P54474 A0A6M3ZEI9
LinkDB
Position
2595669..2596412
AA seq 247 aa
MFSPQQPMRNYPQPGPPRPMPNQRMMGRRPPNMRGPSFGAQQQGFQQAGQFLPQANAGAR
NGAGAGGGLKGMLSRFLPGGGGAGSAGVPGIPGAGAAASGGAGLQGIQNIANPASLSSML
GNVQKVLGMAQQVTPMIQQYGPLVRNLPAMMKLYSQLSKSDDTETEANEESEKQSVSEES
SEKEKETETKTSDGNKKSKPKSSSLPKKSKTTDNKEQELKTSAPKKKEAASPAPKRTSGS
SKPRLYI
NT seq 744 nt   +upstreamnt  +downstreamnt
atgttttcaccgcagcagccaatgagaaattacccacagcccggaccgccccgccccatg
ccaaatcagcgaatgatgggcagaagaccgcctaatatgcgaggaccttcatttggagca
cagcagcaaggttttcagcaagccggacaatttcttcctcaggcaaatgccggagcgaga
aatggtgcaggtgcaggcggaggcttaaaaggaatgctgtcaaggttcctccccggcgga
ggaggcgctggcagcgccggggttcccggaattccaggagcaggtgcagcagcgagcgga
ggtgctggcctgcaaggcattcaaaatattgccaatcctgcatcattatccagtatgctt
ggaaatgtgcaaaaagtactcggcatggcgcagcaagtcacccctatgatccagcagtac
ggcccattagtccgcaatctgccagcaatgatgaagctgtacagccaattaagtaaaagt
gatgatactgagacagaggccaatgaggaaagtgaaaaacaatccgtttcagaagaatca
tcagaaaaagaaaaagagactgaaacaaaaacctcagatgggaacaaaaaatcaaaacca
aaaagttcttctctcccaaagaaatctaaaacaactgacaataaagaacaagaattaaaa
acatctgccccgaagaaaaaggaagctgcctctcctgctccgaaaagaacatcaggcagt
tcaaaaccgagattatatatttaa

DBGET integrated database retrieval system