KEGG   Bacillus subtilis subsp. subtilis 168: BSU25380
Entry
BSU25380          CDS       T00010                                 

Gene name
yqfA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YdfA_immunity Seryl_tRNA_N
Other DBs
NCBI-GeneID: 937865
NCBI-ProteinID: NP_390416
Pasteur: BG11651
BSORF: BG11651
UniProt: P54466 A0A6M4JL38
LinkDB
Position
complement(2617449..2618444)
AA seq 331 aa
MDPSTLMILAIVAVAIIVLAVFFTFVPVMLWISALAAGVKISIFTLVGMRLRRVIPNRVV
NPLIKAHKAGLNVGTNQLESHYLAGGNVDRVVNALIAAQRANIELTFERCAAIDLAGRDV
LEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIERLVGGAGEETIVARVGEGI
VSTIGSSDNHKKVLENPDMISQTVLGKGLDSGTAFEILSIDIADVDIGKNIGAILQTDQA
EADKNIAQAKAEERRAMAVAQEQEMRARVEEMRAKVVEAEAEVPLAMAEALREGNIGVMD
YMNIKNIDADTEMRDSFGKLTKDPSDEDRKS
NT seq 996 nt   +upstreamnt  +downstreamnt
atggatccgtcaacacttatgattctggcaattgtcgcagtagcgatcattgttttggca
gtattttttacatttgtgcctgtaatgctttggatttcagctttggcagccggagtgaaa
atcagcattttcactctagttgggatgaggcttcgccgcgtcattccgaatcgggttgtt
aacccgctgattaaagcgcataaagcgggacttaatgttggaacaaaccagcttgaaagc
cactatctggctggaggtaatgttgacagagtcgtcaacgcgcttatcgccgctcagcga
gctaacattgaactcacattcgagcgctgtgctgccattgatcttgcaggccgggacgtg
ttggaagctgttcaaatgagcgttaatcctaaggtgattgaaacaccgttcattgccggc
gtcgcaatggacgggattgaagtgaaagcgaaagcgagaatcacagtaagagcgaatatc
gagcgcctcgtcgggggagcaggggaagaaaccattgtagctcgtgtaggtgagggaatc
gtttctacaatcggttcatctgataatcataaaaaagtgcttgaaaaccctgacatgatt
tctcagacagtccttggaaaaggattggactcaggaactgcgtttgaaattctctcaatt
gatattgcagatgtagatatcggcaaaaacatcggggcaattttacaaaccgatcaggcc
gaggctgataaaaacatcgcgcaggcaaaagcggaagaacgacgtgcgatggctgtcgct
caagaacaggaaatgcgtgcccgcgtagaagaaatgcgcgcgaaagtagtagaagccgag
gcggaagtgccgcttgcgatggcagaagctttgcgtgaagggaatattggcgtcatggat
tacatgaatatcaagaacatcgatgctgacacagaaatgcgtgattcattcggcaagctg
acgaaagacccttcggatgaagaccgcaaatcataa

DBGET integrated database retrieval system