KEGG   Bacillus subtilis subsp. subtilis 168: BSU25610
Entry
BSU25610          CDS       T00010                                 

Symbol
yqeM
Name
(RefSeq) methyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Ubie_methyltran Methyltransf_12 CMAS MTS NodS TehB Methyltransf_8 MetW TPMT RrnaAD CARME DREV Methyltransf_15 tRNA_U5-meth_tr WXG100 Methyltransf_32 adh_short Methyltransf_24
Other DBs
NCBI-GeneID: 937826
NCBI-ProteinID: NP_390439
Pasteur: BG11641
BSORF: BG11641
UniProt: P54458 A0A6M4JJM6
LinkDB
Position
complement(2642101..2642844)
AA seq 247 aa
MIYQGFASVYDELMSHAPYDQWTKWIEASLPEKGRILDLACGTGEISIRLAEKGFEVTGI
DLSEEMLSFAQQKVSSSQPILFLQQDMREITGFDGQFDAVVICCDSLNYLKTKNDVIETF
KSVFRVLKPEGILLFDVHSSFKIAEVFPDSTFADQDEDISYIWQSFAGSDELSVIHDMSF
FVWNGEAYDRFDETHEQRTFPVEEYEEMLKNCGFQLHRVTADFTDTEPSAQSERLFFKAQ
KSKTIVS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgatttatcaaggctttgcaagcgtgtatgacgagctaatgtcacacgcgccttacgat
caatggacaaaatggattgaagcatctctcccggaaaaaggccgtattctcgatctggca
tgcggcacgggggaaatctccatccggcttgccgaaaaaggcttcgaggttacaggcatc
gatctcagcgaagagatgctttctttcgcccagcaaaaggtatcgagtagccagcctatt
ttatttcttcagcaggatatgagagagattaccggctttgacggtcaatttgacgctgtt
gtgatatgctgtgactcattaaattatttaaaaacaaaaaatgatgtgatcgaaaccttt
aaaagtgtttttcgggtattaaagcctgaaggcatcctgctgtttgatgttcattcatct
tttaaaattgcggaagtctttccggatagcacatttgctgaccaggacgaagatatcagc
tatatttggcagagctttgccggaagtgacgagctttctgtcattcatgatatgtcgttt
tttgtgtggaacggagaagcgtatgatcgttttgatgagacacacgagcaaagaacgttc
ccggtggaagaatacgaagaaatgcttaagaactgcggctttcagctccatcgcgtgaca
gctgattttacggataccgagccatcagcacaatcagaacgcctctttttcaaggcgcag
aaatcaaaaaccatcgtttcctaa

DBGET integrated database retrieval system