KEGG   Bacillus subtilis subsp. subtilis 168: BSU25920
Entry
BSU25920          CDS       T00010                                 

Symbol
yqxG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 937783
NCBI-ProteinID: NP_390469
Pasteur: BG11069
BSORF: BG11069
UniProt: P24810 A0A6M4JNR2
LinkDB
Position
complement(2665903..2666796)
AA seq 297 aa
MASYSFQFSTDATGKPGAAKPYREGNRDFVVPVASISGNSELLTNAVLKATEVYTQYGQD
RLGQVLISKVKGHAYSDREGTLFIEESNDMNSWTTISSLVVKANTLGETEWIHLTKRYFR
FRYANGNLQQSEFLLYQSLGAGEEDININHTVPITAVAPFSVQLDKSGLTNDGRLKVQTE
GLNLSSLDTQSKTMDIVFHDKTETIGEGNPFTVGSFKTLLIEVYGTAETSELKFWGKSLS
GTKRALRGQKVDDGTFATSTKGKSEAWSFSITGFKEIVMELTALTNGNFSVRGTAVS
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcatcatatagttttcaattttcaacagatgcaactggtaagccgggggcagccaag
ccatacagagaaggaaacagagattttgttgtgccggtagcttcaatctccggtaattca
gagctgctgacgaacgcagttttaaaagccactgaagtctacacgcaatatggacaagat
cgattaggtcaggttttaatttcaaaagtaaaaggtcacgcttattctgatcgtgaaggt
accttattcattgaagaaagtaacgatatgaattcatggaccacaatctcttcattggtt
gttaaagcaaatacgcttggcgagactgagtggattcatttaactaaacgatatttccgt
ttcagatacgcaaatggtaacctgcagcaatctgaattcttactttaccagtcattgggc
gcaggtgaagaggatataaacattaaccatactgttcctattacagcagttgctccgttc
tcagtccagttagataaaagcgggttaactaatgatggtcgtttaaaagttcaaactgaa
ggcttgaatcttagctcattagacactcaatcaaaaacaatggatattgtctttcacgat
aaaacagaaaccataggtgagggtaacccattcaccgttggatcattcaaaacgttgctc
attgaggtttatgggacggctgagacaagtgaattgaagttctggggtaaatccttatcg
ggaacaaaaagagcccttagagggcagaaagtggatgacggaacgtttgccactagcaca
aaaggaaaatcagaagcttggtcttttagcattactggctttaaagaaattgttatggag
cttacagctttaacaaatggaaacttttcagttagagggacggccgtctcataa

DBGET integrated database retrieval system