KEGG   Bacillus subtilis subsp. subtilis 168: BSU26240
Entry
BSU26240          CDS       T00010                                 

Symbol
yqaO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PBSX_XtrA
Other DBs
NCBI-GeneID: 937706
NCBI-ProteinID: NP_390501
Pasteur: BG11266
BSORF: BG11266
UniProt: P45912 A0A6M3ZE68
LinkDB
Position
complement(2692645..2692851)
AA seq 68 aa
MYNPREINIKKDFTIQQKIDPGKVQIIVLDGNQGTAHVLDAPEHGKTVIQTVKGSFARVD
HEIGFKVK
NT seq 207 nt   +upstreamnt  +downstreamnt
gtgtacaatccaagagaaataaacatcaaaaaagacttcactattcagcagaaaattgac
ccaggaaaagttcagatcattgttttagatgggaatcagggaactgcacatgttttagat
gctccggagcacggcaaaacagtgattcaaactgtaaagggcagctttgcaagggttgat
catgagatagggtttaaggtgaaatga

DBGET integrated database retrieval system