KEGG   Bacillus subtilis subsp. subtilis 168: BSU27000
Entry
BSU27000          CDS       T00010                                 

Gene name
yraB
Definition
(RefSeq) MerR family transcriptional regulator
  KO
K21745  MerR family transcriptional regulator, aldehyde-responsive regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU27000 (yraB)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    BSU27000 (yraB)
SSDB
Motif
Pfam: MerR_1 MerR MerR-DNA-bind FliD_C Cdh1_DBD_1 DUF4200 HTH_17 ATG14 G2BR
Other DBs
NCBI-GeneID: 937605
NCBI-ProteinID: NP_390578
Pasteur: BG13777
BSORF: BG13777
UniProt: O06008 A0A6M4JKB6
LinkDB
Position
complement(2755382..2755804)
AA seq 140 aa
MNIAQVAKQFGLTAATLRYYERVGLIPPVKRKDSGIRDYDEEDIKWIEFIKCMRNAGLSI
EALIEYTTLFTEGDRTVEARKNILADERQRLIEKRKEIDETIKRLDTKIKDYDGKLRENE
AKLKSRPKTESLHGSVEQRR
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaatattgctcaggtggcaaagcagtttggcctgacagccgcaacactccgatattac
gaacgtgtaggattaatcccgcctgtaaaacgaaaagacagcggcattcgcgactatgat
gaagaagatatcaaatggattgaattcattaaatgcatgcgaaatgcgggactatcgata
gaagcgctaattgaatatacaacattatttaccgaaggtgaccgtacggtagaagctcga
aaaaatatcctggctgacgaacgacagcggctgatagagaagcggaaagaaattgatgaa
acaattaagagattagacacaaaaattaaagattatgatgggaaattgcgtgaaaatgag
gcaaagctcaaaagcaggcctaaaacggaaagtcttcacggatcagtggagcaaagaagg
tag

DBGET integrated database retrieval system