KEGG   Bacillus subtilis subsp. subtilis 168: BSU27010
Entry
BSU27010          CDS       T00010                                 
Symbol
adhA
Name
(RefSeq) formaldehyde dehydrogenase AdhA
  KO
K13979  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00561  Glycerolipid metabolism
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU27010 (adhA)
   00620 Pyruvate metabolism
    BSU27010 (adhA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU27010 (adhA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     BSU27010 (adhA)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Shikimate_DH NAD_binding_2 NAD_binding_7 IGFBP 3HCDH_N
Other DBs
NCBI-GeneID: 938739
NCBI-ProteinID: NP_390579
Pasteur: BG12562
BSORF: BG12562
UniProt: C0SPA5 A0A6M4JM77
LinkDB
Position
2756312..2757361
AA seq 349 aa
MCNQHQTRVLSVSHAKAKFEQTTIERRGLRPHDVLIDIKFSGICHSDIHSAFDEWGGGIF
PMVPGHEIAGVVTAVGTKVTKLAVGDRVGVGCFVDSCGECEYCLNAEEQFCTKGVVQTYN
SVDYDGNPTYGGYSQKIVVTDRFVVRIPDRLEMDVASPLLCAGITTYSPLKHWNVGPGKK
VAIVGVGGLGHLAIQFAHAMGAEVTVLSRSMNKKEEALELGANHYFATSDPATFTALAGR
FDVILNTVSANLDVDAYLSMLRIDGTLVSVGAPAKPDTYSVFSLIMGRRSIAGSLVGGIQ
ETQEMLDFAAEHGIEPKIEVIGADQVDEAYERILRSDVRYRFVIDISTL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtgtaatcaacatcaaacccgtgtattaagcgtgtcacatgcaaaagccaaatttgaa
caaacgacgattgagcgaagaggattacggccgcacgatgtcttaatcgatattaaattc
agcggcatttgccattcagacattcatagcgcttttgatgaatggggcggtggcatcttc
ccaatggtgcctggacatgaaatagccggtgttgtaacagccgttggaacaaaagtcacc
aagttggctgtcggggaccgcgttggtgtcggctgttttgttgactcttgcggagaatgc
gaatactgtctcaacgcagaggaacaattctgcacgaagggtgttgttcaaacgtataac
tcagtagactacgacggaaaccccacttatggcgggtacagccaaaaaatcgttgtcact
gacagatttgttgttcgcataccagatcgtttggaaatggatgttgccagtccgctgttg
tgtgcaggtatcacaacgtattccccgctgaaacactggaatgttggccctggtaaaaag
gttgcgattgtaggcgtaggtggccttggacatttggcaattcaatttgcacatgcgatg
ggtgcagaagtaaccgtcctgagccgttccatgaataagaaagaggaagctctggaactc
ggtgcaaatcattactttgcaacaagtgacccagccacattcactgcattggccgggcgt
tttgacgtgatcttaaatacggtatcggcaaatctcgatgtagatgcctatttatcaatg
cttcgtatagacgggacacttgtaagcgttggagctcctgccaagccggacacatacagt
gtgttttccctaatcatggggcgccgcagcattgcaggttctctagtcggcggaattcaa
gaaactcaagagatgctggatttcgcagctgagcatggcatcgaacctaaaatcgaagtc
atcggagctgaccaagtggacgaggcatacgaacgtatcctccgaagcgatgtccgttat
cgatttgtgattgatatttccacattgtaa

DBGET integrated database retrieval system