KEGG   Bacillus subtilis subsp. subtilis 168: BSU27070
Entry
BSU27070          CDS       T00010                                 

Gene name
levD
Definition
(RefSeq) PTS system-fructose-specific transporter subunit IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU27070 (levD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU27070 (levD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU27070 (levD)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BSU27070 (levD)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSU27070 (levD)
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-GeneID: 936536
NCBI-ProteinID: NP_390585
Pasteur: BG10316
BSORF: BG10316
UniProt: P26379
LinkDB
Position
complement(2762395..2762835)
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHE
VLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSLREHLALKDLLNNLKAMS
QQSFQVCSEHLEKVKTANQDTREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgattgcagtgccgtttttcaaaggggaagga
atacaaacgctgcaagaaaaatatcatcaggcgctcaaggatatcccggaagaacatgaa
gtgctttttttagtcgatatttttggagggacgccatataacgcggcagcttcctttatt
gctgaggatcaaagaatggatatggctgccggcgtaaacctgccgattctgctggaggta
ttaagcctgagagaacatctggctctcaaagatttgctgaacaacttaaaagcaatgagt
cagcaaagctttcaagtgtgcagtgaacatttagaaaaagtaaaaacagccaatcaagat
acaagagaggatgaattatga

DBGET integrated database retrieval system